• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated MTHFD1 Monoclonal antibody

MTHFD1 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-67670
Clone No.2B1G3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

MTHFC, Epididymis secretory sperm binding protein, C1-THF synthase, C-1-tetrahydrofolate synthase, cytoplasmic, N-terminally processed, C-1-tetrahydrofolate synthase, cytoplasmic

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHEK-293 cells
Positive FC (Intra) detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67670 targets MTHFD1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag24553

Product name: Recombinant human MTHFD1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 536-935 aa of BC009806

Sequence: TNDRFLRKITIGQAPTEKGHTRTAQFDISVASEIMAVLALTTSLEDMRERLGKMVVASSKKGEPVSAEDLGVSGALTVLMKDAIKPNLMQTLEGTPVFVHAGPFANIAHGNSSIIADQIALKLVGPEGFVVTEAGFGADIGMEKFFNIKCRYSGLCPHVVVLVATVRALKMHGGGPTVTAGLPLPKAYIQENLELVEKGFSNLKKQIENARMFGIPVVVAVNAFKTDTESELDLISRLSREHGAFDAVKCTHWAEGGKGALALAQAVQRAAQAPSSFQLLYDLKLPVEDKIRIIAQKIYGADDIELLPEAQHKAEVYTKQGFGNLPICMAKTHLSLSHNPEQKGVPTGFILPIRDIRASVGAGFLYPLVGTMSTMPGLPTRPCFYDIDLDPETEQVNGLF

Predict reactive species
Full Name methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1, methenyltetrahydrofolate cyclohydrolase, formyltetrahydrofolate synthetase
Calculated Molecular Weight 101 kDa
Observed Molecular Weight 101 kDa
GenBank Accession NumberBC009806
Gene Symbol MTHFD1
Gene ID (NCBI) 4522
RRIDAB_3084371
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP11586
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

MTHFD1 is a trifunctional enzyme involved in the pathway tetrahydrofolate interconversion, which is part of One-carbon metabolism. MTHFD1 is associated with HCC and CRC progression. It has been reported that MTHFD-deficient patient fibroblasts exhibit enriched MTHFD1 in the nucleus which is critical for de novo dTMP synthesis.(PMID: 31133746, 30997850, 31421459, 25548164)

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 MTHFD1 antibody CL488-67670Download protocol
FC protocol for CL Plus 488 MTHFD1 antibody CL488-67670Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...