CoraLite® Plus 488-conjugated MTHFD1 Monoclonal antibody

• 

  IF Staining of HEK-293 using CL488-67670

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using CoraLite® Plus 488 MTHFD1 antibody (CL488-67670, Clone: 2B1G3 ) at dilution of 1:200.

• 

  FC experiment of HEK-293 using CL488-67670

  1X10^6 HEK-293 cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human MTHFD1 (CL488-67670, Clone:2B1G3) (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• Featured Product
• KD/KO Validated

MTHFD1 Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-67670

Clone No.2B1G3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Synonyms

MTHFC, Epididymis secretory sperm binding protein, C1-THF synthase, C-1-tetrahydrofolate synthase, cytoplasmic, N-terminally processed, C-1-tetrahydrofolate synthase, cytoplasmic

---

Tested Applications

• Positive IF/ICC detected in: HEK-293 cells
• Positive FC (Intra) detected in: HEK-293 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67670 targets MTHFD1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24553

  Product name: Recombinant human MTHFD1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 536-935 aa of BC009806

  Sequence: TNDRFLRKITIGQAPTEKGHTRTAQFDISVASEIMAVLALTTSLEDMRERLGKMVVASSKKGEPVSAEDLGVSGALTVLMKDAIKPNLMQTLEGTPVFVHAGPFANIAHGNSSIIADQIALKLVGPEGFVVTEAGFGADIGMEKFFNIKCRYSGLCPHVVVLVATVRALKMHGGGPTVTAGLPLPKAYIQENLELVEKGFSNLKKQIENARMFGIPVVVAVNAFKTDTESELDLISRLSREHGAFDAVKCTHWAEGGKGALALAQAVQRAAQAPSSFQLLYDLKLPVEDKIRIIAQKIYGADDIELLPEAQHKAEVYTKQGFGNLPICMAKTHLSLSHNPEQKGVPTGFILPIRDIRASVGAGFLYPLVGTMSTMPGLPTRPCFYDIDLDPETEQVNGLF

• Full Name: methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1, methenyltetrahydrofolate cyclohydrolase, formyltetrahydrofolate synthetase
• Calculated Molecular Weight: 101 kDa
• Observed Molecular Weight: 101 kDa
• GenBank Accession Number: BC009806
• Gene Symbol: MTHFD1
• Gene ID (NCBI): 4522
• RRID: AB_3084371
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P11586
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

MTHFD1 is a trifunctional enzyme involved in the pathway tetrahydrofolate interconversion, which is part of One-carbon metabolism. MTHFD1 is associated with HCC and CRC progression. It has been reported that MTHFD-deficient patient fibroblasts exhibit enriched MTHFD1 in the nucleus which is critical for de novo dTMP synthesis.(PMID: 31133746, 30997850, 31421459, 25548164)