MTHFSD Polyclonal antibody

• 

  WB analysis using 32122-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32122-1-AP (MTHFSD antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

MTHFSD Polyclonal Antibody for WB, ELISA

Cat No. 32122-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Methenyltetrahydrofolate Synthetase Domain-Containing Protein, Methenyltetrahydrofolate Synthetase Domain Containing, Methenyltetrahydrofolate synthase domain-containing protein

---

Tested Applications

• Positive WB detected in: A549 cells, HaCaT cells, MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32122-1-AP targets MTHFSD in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37100

  Product name: Recombinant human MTHFSD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of BC112059

  Sequence: MEPRAVGVSKQDIREQIWGYMESQNLADFPRPVHHRIPNFKGSYLACQNIKDLDVFARTQEVKVDPDKPLEGVRLLVLQSKKTLLVPTPRLRTGLFNKITPPPGATKDILRKCATSQGVRNYSVPIGLDSRVLVDLVVVGSVAVSEKGWRIGKGEGYADLEYAMMVSMGAVSKETPVVTIVHDCQVVDIPEELVEEHDIT

• Full Name: methenyltetrahydrofolate synthetase domain containing
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC112059
• Gene Symbol: MTHFSD
• Gene ID (NCBI): 64779
• RRID: AB_3670199
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q2M296
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MTHFSD is an RNA-binding protein that contains a methyltetrahydrofolate synthase structural domain and an RRM structural domain. In healthy motor neurons, MTHFSD is predominantly located in the nucleus, and studies have shown that MTHFSD, as a novel marker of stress granules, may be associated with aggregated proteins involved in amyotrophic lateral sclerosis (ALS).