Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

MTMR15/FAN1 Polyclonal antibody

MTMR15/FAN1 Polyclonal Antibody for WB, IP, ELISA

Cat No. 17600-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, ELISA

MTMR15, EC:3.1.21.-, FAN1, FANCD2/FANCI-associated nuclease 1, Fanconi-associated nuclease 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, human spleen tissue
Positive IP detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17600-1-AP targets MTMR15/FAN1 in WB, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag11651

Product name: Recombinant human MTMR15 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 186-534 aa of BC047882

Sequence: STVVKSLIDNSSEIEDEDQILENSSQKENVFKCDSLKEECIPEHMVRESKIMEAESQKATRECEKSALTPGFSDNAIMLFSPDFTLRNTLKSTSEDSLVKQECIKEVVEKREACHCEEVKMTVASEAKIQLSDSEAKSHSSADDASAWSNIQEAPLQDDSCLNNDIPHSIPLEQGSSCNGPGQTTGHPYYLRSFLVVLKTVLENEDDMLLFDEQEKGIVTKFYQLSATGQKLYVRLFQRKLSWIKMTKLEYEEIALDLTPVIEELTNAGFLQTESELQELSEVLELLSAPELKSLAKTFHLVNPNGQKQQLVDAFLKLAKQRSVCTWGKNKPGIGAVILKRFCWLLLQ

Predict reactive species
Full Name myotubularin related protein 15
Calculated Molecular Weight 60 kDa, 114 kDa
Observed Molecular Weight 63-68 kDa, 120-140 kDa
GenBank Accession NumberBC047882
Gene Symbol MTMR15
Gene ID (NCBI) 22909
RRIDAB_10598016
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9Y2M0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MTMR15, also named as FAN1 and KIAA1018, is a nuclease required for the repair of DNA interstrand cross-links (ICL) recruited at sites of DNA damage by monoubiquitinated FANCD2. It is specifically involved in repair of ICL-induced DNA breaks by being required for efficient homologous recombination, probably in the resolution of homologous recombination intermediates. MTMR15 has some isoforms with MW 114 kDa and 60 kDa. The MW will be migrated to 120-140 kDa and 63-68 kDa with modification.

Protocols

Product Specific Protocols
IP protocol for MTMR15/FAN1 antibody 17600-1-APDownload protocol
WB protocol for MTMR15/FAN1 antibody 17600-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
WB

Nat Struct Mol Biol

Fanconi anemia proteins participate in a break-induced-replication-like pathway to counter replication stress.

Authors - Xinlin Xu
humanWB,IP

Genes Cells

MLH1-mediated recruitment of FAN1 to chromatin for the induction of apoptosis triggered by O6 -methylguanine.

Authors - Mihoko Rikitake
  • KD Validated
humanWB

Cell Rep

HIV-1 exploits the Fanconi anemia pathway for viral DNA integration.

Authors - Shaozu Fu
humanWB

Genet Med

Polygenic variants in DNA repair genes are associated with neurodevelopmental disorders, regression and increased burdens of somatic variants and short tandem repeat expansions.

Authors - Maria Cerminara
  • KD Validated
humanWB

Nat Commun

Structural and molecular basis of PCNA-activated FAN1 nuclease function in DNA repair

Authors - F Li

Nat Commun

Structural insights into the MLH1-FAN1 interaction reveal an uncharacterized binding interface on MLH1.

Authors - Yichang Chen

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Alexandra (Verified Customer) (07-04-2024)

Detectable both with endogenous and overexpressed protein from plasmid. One of the two bands ran in between the two expected molecular weights, the other was at the proper size. It is usable for the examination of the effect of endogenous gene silencing and for overexpression as well. Possibly higher dilution and longer incubation with the antibody is enough.

  • Applications: Western Blot, Immunofluorescence, Cell culture
  • Primary Antibody Dilution: 1000x
  • Cell Tissue Type: U2OS human osteosarcoma cell line
MTMR15/FAN1 Antibody Western Blot,Immunofluorescence,Cell culture validation (1000x dilution) in U2OS human osteosarcoma cell line (Cat no:17600-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...