MTMR15/FAN1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MTMR15/FAN1 Polyclonal antibody, PBS Only (17600-1-PBS)

• 

  WB analysis using 17600-1-AP (same clone as 17600-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17600-1-AP (MTMR15 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17600-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human spleen using 17600-1-AP (same clone as 17600-1-PBS)

  human spleen tissue were subjected to SDS PAGE followed by western blot with 17600-1-AP (MTMR15 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17600-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 17600-1-AP (same clone as 17600-1-PBS)

  IP result of anti-MTMR15 (IP:17600-1-AP, 4ug; Detection:17600-1-AP 1:300) with HeLa cells lysate 2800 ug. This data was developed using the same antibody clone with 17600-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MTMR15/FAN1 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 17600-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Indirect ELISA

Synonyms

MTMR15, EC:3.1.21.-, FAN1, FANCD2/FANCI-associated nuclease 1, Fanconi-associated nuclease 1

---

Product Information

17600-1-PBS targets MTMR15/FAN1 in WB, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11651

  Product name: Recombinant human MTMR15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 186-534 aa of BC047882

  Sequence: STVVKSLIDNSSEIEDEDQILENSSQKENVFKCDSLKEECIPEHMVRESKIMEAESQKATRECEKSALTPGFSDNAIMLFSPDFTLRNTLKSTSEDSLVKQECIKEVVEKREACHCEEVKMTVASEAKIQLSDSEAKSHSSADDASAWSNIQEAPLQDDSCLNNDIPHSIPLEQGSSCNGPGQTTGHPYYLRSFLVVLKTVLENEDDMLLFDEQEKGIVTKFYQLSATGQKLYVRLFQRKLSWIKMTKLEYEEIALDLTPVIEELTNAGFLQTESELQELSEVLELLSAPELKSLAKTFHLVNPNGQKQQLVDAFLKLAKQRSVCTWGKNKPGIGAVILKRFCWLLLQ

• Full Name: myotubularin related protein 15
• Calculated Molecular Weight: 60 kDa, 114 kDa
• Observed Molecular Weight: 63-68 kDa, 120-140 kDa
• GenBank Accession Number: BC047882
• Gene Symbol: MTMR15
• Gene ID (NCBI): 22909
• RRID: AB_10598016
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2M0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MTMR15, also named as FAN1 and KIAA1018, is a nuclease required for the repair of DNA interstrand cross-links (ICL) recruited at sites of DNA damage by monoubiquitinated FANCD2. It is specifically involved in repair of ICL-induced DNA breaks by being required for efficient homologous recombination, probably in the resolution of homologous recombination intermediates. MTMR15 has some isoforms with MW 114 kDa and 60 kDa. The MW will be migrated to 120-140 kDa and 63-68 kDa with modification.