MUC1/CA15-3 Monoclonal antibody, PBS Only

• 

  IHC staining of human rectal cancer using 60749-1-Ig (same clone as 60749-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human rectal cancer tissue slide using 60749-1-Ig (MUC1/CA15-3 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60749-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human rectal cancer using 60749-1-Ig (same clone as 60749-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human rectal cancer tissue slide using 60749-1-Ig (CA15-3,MUC1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60749-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 60749-1-Ig (same clone as 60749-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 60749-1-Ig (MUC1/CA15-3 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60749-1-PBS in a different storage buffer formulation.

MUC1/CA15-3 Monoclonal Antibody for IHC, Indirect ELISA

Cat No. 60749-1-PBS

Clone No.1D5D11

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

CA15-3, CA153, MUC1, CA15 3, CA 15-3

---

Product Information

60749-1-PBS targets MUC1/CA15-3 in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17660

  Product name: Recombinant human CA15-3,MUC1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1055-1255 aa of BC120975

  Sequence: NSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWGIALLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL

• Full Name: mucin 1, cell surface associated
• Calculated Molecular Weight: 1264 aa, 123 kDa
• GenBank Accession Number: BC120975
• Gene Symbol: MUC1/CA15-3
• Gene ID (NCBI): 4582
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P15941
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MUC1 is a type I transmembrane glycoprotein expressed by various epithelial cells of the female reproductive tract, lung, breast, kidney, stomach, and pancreas.. Among the known mucins, MUC1 is best studied and plays crucial roles in regulating many cellular properties, including cell proliferation, apoptosis, adhesion, and invasion. MUC1 is overexpressed in a wide range of human epithelial malignancies.