• Featured Product
  • KD/KO Validated

MYBBP1A Monoclonal antibody

MYBBP1A Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 67996-1-Ig
Clone No.1H2D10

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

1H2D10, Myb binding protein 1A, Myb-binding protein 1A, PAP2

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, 4T1 cells, HEK-293 cells, HSC-T6 cells, NIH/3T3 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells
Positive IHC detected inhuman kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells, NIH/3T3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:300-1:1200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67996-1-Ig targets MYBBP1A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6008

Product name: Recombinant human MYBBP1A protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 979-1328 aa of BC050546

Sequence: STALSSFLTKRNSPLTVPMFLSLFSRHPVLCQSLLPILVQHITGPVRPRRQACLLLQKTLSMREVRSCFEDPEWKQLMGQVLAKVTENLRVLGEAQTKAQHQQALSSLELLNVLFRTCKHEKLTLDLTVLLGVLQGQQQSLQQGAHSTGSSRLHDLYWQAMKTLGVQRPKLEKKDAKEIPSATQSPISKKRKKKGFLPETKKRKKRKSEDGTPAEDGTPAATGGSQPPSMGRKKRNRTKAKVPAQANGTPTTKSPAPGAPTRSPSTPAKSPKLQKKNQKPSQVNGAPGSPTEPAGQKQHQKALPKKGVLGKSPLSALARKKARLSLVIRSPSLLQSGAKKKAQVRKAGKP

Predict reactive species
Full Name MYB binding protein (P160) 1a
Calculated Molecular Weight 149 kDa
Observed Molecular Weight140 kDa
GenBank Accession NumberBC050546
Gene Symbol MYBBP1A
Gene ID (NCBI) 10514
RRIDAB_2918745
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9BQG0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The protooncogene MYB is predominantly expressed in immature hemopoietic cells where it has an essential role in hemopoietic cell proliferation and differentiation. Oncogenically activated forms of MYB is generally N- and/or C-terminal truncations of the normal MYB protein. Removal of the C terminus of MYB disrupts or deletes a region termed the negative regulatory domain (NRD), resulting in an increase in DNA binding, transactivation, and transformation by MYB. One feature of the NRD is a leucine zipper-like motif [PMID: 8302594]. Murine Myb-binding protein-1a (MYBBP1A), originally called P160, was identified by its ability to interact specifically with Myb via this leucine zipper-like motif. MYBBP1A modulates MYB activity upon binding to the MYB NRD [PMID: 10644447, 9447996].

Protocols

Product Specific Protocols
WB protocol for MYBBP1A antibody 67996-1-IgDownload protocol
IHC protocol for MYBBP1A antibody 67996-1-IgDownload protocol
IF protocol for MYBBP1A antibody 67996-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...