• KD/KO Validated

CoraLite®594-conjugated MYBBP1A Monoclonal antibody

MYBBP1A Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL594-67996
Clone No.1H2D10

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat

Applications

IF/ICC, FC (Intra)

PAP2, Myb-binding protein 1A, Myb binding protein 1A, 1H2D10

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67996 targets MYBBP1A in IF/ICC, FC (Intra) applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6008

Product name: Recombinant human MYBBP1A protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 979-1328 aa of BC050546

Sequence: STALSSFLTKRNSPLTVPMFLSLFSRHPVLCQSLLPILVQHITGPVRPRRQACLLLQKTLSMREVRSCFEDPEWKQLMGQVLAKVTENLRVLGEAQTKAQHQQALSSLELLNVLFRTCKHEKLTLDLTVLLGVLQGQQQSLQQGAHSTGSSRLHDLYWQAMKTLGVQRPKLEKKDAKEIPSATQSPISKKRKKKGFLPETKKRKKRKSEDGTPAEDGTPAATGGSQPPSMGRKKRNRTKAKVPAQANGTPTTKSPAPGAPTRSPSTPAKSPKLQKKNQKPSQVNGAPGSPTEPAGQKQHQKALPKKGVLGKSPLSALARKKARLSLVIRSPSLLQSGAKKKAQVRKAGKP

Predict reactive species
Full Name MYB binding protein (P160) 1a
Calculated Molecular Weight 149 kDa
Observed Molecular Weight140 kDa
GenBank Accession NumberBC050546
Gene Symbol MYBBP1A
Gene ID (NCBI) 10514
RRIDAB_2923939
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9BQG0
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The protooncogene MYB is predominantly expressed in immature hemopoietic cells where it has an essential role in hemopoietic cell proliferation and differentiation. Oncogenically activated forms of MYB is generally N- and/or C-terminal truncations of the normal MYB protein. Removal of the C terminus of MYB disrupts or deletes a region termed the negative regulatory domain (NRD), resulting in an increase in DNA binding, transactivation, and transformation by MYB. One feature of the NRD is a leucine zipper-like motif [PMID: 8302594]. Murine Myb-binding protein-1a (MYBBP1A), originally called P160, was identified by its ability to interact specifically with Myb via this leucine zipper-like motif. MYBBP1A modulates MYB activity upon binding to the MYB NRD [PMID: 10644447, 9447996].

Protocols

Product Specific Protocols
FC protocol for CL594 MYBBP1A antibody CL594-67996Download protocol
IF protocol for CL594 MYBBP1A antibody CL594-67996Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...