MYCBP Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MYCBP Polyclonal antibody, PBS Only (12022-1-PBS)

• 

  WB analysis of human heart using 12022-1-AP (same clone as 12022-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 12022-1-AP (MYCBP antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12022-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 12022-1-AP (same clone as 12022-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12022-1-AP (MYCBP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12022-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human kidney using 12022-1-AP (same clone as 12022-1-PBS)

  human kidney tissue were subjected to SDS PAGE followed by western blot with 12022-1-AP (MYCBP antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12022-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human lung using 12022-1-AP (same clone as 12022-1-PBS)

  human lung tissue were subjected to SDS PAGE followed by western blot with 12022-1-AP (MYCBP antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12022-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 12022-1-AP (same clone as 12022-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 12022-1-AP (MYCBP antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12022-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 12022-1-AP (same clone as 12022-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 12022-1-AP (MYCBP antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12022-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 12022-1-AP (same clone as 12022-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 12022-1-AP (MYCBP antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12022-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 12022-1-AP (same clone as 12022-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 12022-1-AP (MYCBP antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12022-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 12022-1-AP (same clone as 12022-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 12022-1-AP (MYCBP antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12022-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 12022-1-AP (same clone as 12022-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using MYCBP antibody (12022-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 12022-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MYCBP Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 12022-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

c-Myc-binding protein, Associate of Myc 1, AMY-1, AMY1, AMY 1

---

Product Information

12022-1-PBS targets MYCBP in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2651

  Product name: Recombinant human MYCBP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-103 aa of BC008686

  Sequence: MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE

• Full Name: c-myc binding protein
• Calculated Molecular Weight: 103 aa, 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC008686
• Gene Symbol: MYCBP
• Gene ID (NCBI): 26292
• RRID: AB_2148722
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99417
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MYC binding protein(MYCBP), encoded by MYCBP gene, binds to N-terminal region of MYC, and then MYC can activate E box-dependent transcription. Upon increasing expression of MYC , MYCBP translocates into the nucleus in the S phase of the cell cycle. MYCBP may involve in spermatogenesis, since it's found to be interacted with AKAP84/149 in the mitochondria in somatic cells and sperm. It highly expressed in heart, placenta, pancreas,skeletal muscle and kidney, but low in lung. This is a rabbit polyclonal antibody raised against full-length MYCBP of human origin.