Home
Products
Primary Antibodies
MYCN Polyclonal antibody, PBS Only (10159-2-PBS)

Filter: AllWBIHC

WB analysis of human placenta using 10159-2-AP (same clone as 10159-2-PBS)
human placenta tissue were subjected to SDS PAGE followed by western blot with 10159-2-AP (MYCN antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10159-2-PBS in a different storage buffer formulation.
WB analysis of human placenta using 10159-2-AP (same clone as 10159-2-PBS)
human placenta tissue were subjected to SDS PAGE followed by western blot with 10159-2-AP (MYCN Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10159-2-PBS in a different storage buffer formulation.
WB analysis of SKOV-3 using 10159-2-AP (same clone as 10159-2-PBS)
SKOV-3 cells were subjected to SDS PAGE followed by western blot with 10159-2-AP (MYCN antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10159-2-PBS in a different storage buffer formulation.
WB analysis of C6 using 10159-2-AP (same clone as 10159-2-PBS)
C6 cells were subjected to SDS PAGE followed by western blot with 10159-2-AP (MYCN antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10159-2-PBS in a different storage buffer formulation.
WB analysis of SH-SY5Y using 10159-2-AP (same clone as 10159-2-PBS)
SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 10159-2-AP (MYCN antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10159-2-PBS in a different storage buffer formulation.
WB analysis of mouse brain using 10159-2-AP (same clone as 10159-2-PBS)
mouse brain tissue were subjected to SDS PAGE followed by western blot with 10159-2-AP (MYCN antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10159-2-PBS in a different storage buffer formulation.
WB analysis of rat brain using 10159-2-AP (same clone as 10159-2-PBS)
rat brain tissue were subjected to SDS PAGE followed by western blot with 10159-2-AP (MYCN antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10159-2-PBS in a different storage buffer formulation.
IHC staining of human thyroid cancer using 10159-2-AP (same clone as 10159-2-PBS)
Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 10159-2-AP (MYCN Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10159-2-PBS in a different storage buffer formulation.
IHC staining of human thyroid cancer using 10159-2-AP (same clone as 10159-2-PBS)
Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 10159-2-AP (MYCN Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10159-2-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

MYCN Polyclonal antibody, PBS Only

Name: MYCN Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 10159-2-PBS

MYCN Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 10159-2-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

10159-2-PBS targets MYCN in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag0193 Product name: Recombinant human MYCN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 289-464 aa of BC002712 Sequence: SNTKAVTTFTITVRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKIKSEASPRPLKSVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKVVILKKATEYVHSLQAEEHQLLLEKEKLQARQQQLLKKIEHARTC Predict reactive species
Full Name	v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian)
Calculated Molecular Weight	50 kDa
Observed Molecular Weight	65-70 kDa
GenBank Accession Number	BC002712
Gene Symbol	MYCN
Gene ID (NCBI)	4613
RRID	AB_2266881
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P04198
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

MYCN, also named as BHLHE37 and NMYC, is a transcription factor. It is primarily expressed in normal developing embryos and is thought to be critical in brain and other neural development. It is often amplified in human neuroblastomas. IR34A can suppress MYCN expression, it suggest MYCN has a role in cell growth. The expression of the MCYN is upregulated in a variety of human tumors, most frequently neuroblastoma, where the level of expression appears to increase as the tumor progresses. The calculated molecuar weight of MYCN is 50 kDa, but Phosphorylated MYCN is about 65-70 kDa. MYCN exsits two isoforms and MV of isoform is respectively 65 kDa and 45 kDa. (PMID: 19615087 )