MYCT1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MYCT1 Polyclonal antibody, PBS Only (22004-1-PBS)

• 

  WB analysis of mouse brain using 22004-1-AP (same clone as 22004-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 22004-1-AP (MYCT1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22004-1-PBS in a different storage buffer formulation.

MYCT1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 22004-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

22004-1-PBS targets MYCT1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4800

  Product name: Recombinant human MYCT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-220 aa of BC022556

  Sequence: LAVLQRDRIKLLFFDILVFLSVFLLFLLFLVDIMANNTTSLGSPWPENFWEDLIMSFTVSMAIGLVLGGFIWAVFICLSRRRRASAPISQWSSSRRSRSSYTHGLNRTGFYGHSGCERRSNLSLASLTFQRQASLEQANSFPRKSSFRASTFHPFLQCPPLPVETESQLVTLPSSNISPTISTSHSLSRPDYWSSNSLRVGLSTPPPPAYESIIKAFPDS

• Full Name: myc target 1
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 27-30 kDa
• GenBank Accession Number: BC022556
• Gene Symbol: MYCT1
• Gene ID (NCBI): 80177
• RRID: AB_2878968
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q8N699
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.