MYL4 Monoclonal antibody, PBS Only

• 

  WB analysis using 67533-1-Ig (same clone as 67533-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67533-1-Ig (MYL4 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67533-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67533-1-Ig (same clone as 67533-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67533-1-Ig (MYL4 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67533-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 67533-1-Ig (same clone as 67533-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 67533-1-Ig (MYL4 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67533-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse heart using 67533-1-Ig (same clone as 67533-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using MYL4 antibody (67533-1-Ig, Clone: 2F5C1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67533-1-PBS in a different storage buffer formulation.

• 

  FC experiment of C2C12 using 67533-1-Ig (same clone as 67533-1-PBS)

  1X10^6 C2C12 cells were intracellularly stained with 0.4 ug Anti-Human MYL4 (67533-1-Ig, Clone:2F5C1) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 67533-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MYL4 Monoclonal Antibody for WB, IHC, IF-P, FC (Intra), ELISA

Cat No. 67533-1-PBS

Clone No.2F5C1

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, FC (Intra), ELISA

Synonyms

2F5C1, MLC1, MYL 4, Myosin light chain 4, Myosin light chain alkali GT-1 isoform

---

Product Information

67533-1-PBS targets MYL4 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19244

  Product name: Recombinant human MYL4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-197 aa of BC030228

  Sequence: MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG

• Full Name: myosin, light chain 4, alkali; atrial, embryonic
• Calculated Molecular Weight: 197 aa, 22 kDa
• Observed Molecular Weight: 22-25 kDa
• GenBank Accession Number: BC030228
• Gene Symbol: MYL4
• Gene ID (NCBI): 4635
• RRID: AB_2882752
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P12829
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Myosin light‐chain 4 (MYL4) encodes an essential myosin light chain that is expressed in embryonic whole heart and skeletal muscle. It is specifically expressed in human atria after birth. MYL4 is essential for atrial electrical, functional, and structural integrity, and MYL4 dysfunction can produce severe inherited atrial cardiomyopathy.