• Featured Product
  • KD/KO Validated

MYL4 Monoclonal antibody

MYL4 Monoclonal Antibody for WB, IHC, IF-P, FC (Intra), ELISA
Cat No. 67533-1-Ig
Clone No.2F5C1

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, FC (Intra), ELISA

2F5C1, MLC1, MYL 4, Myosin light chain 4, Myosin light chain alkali GT-1 isoform

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inpig heart tissue, K-562 cells, Mo7e cells, TF-1 cells, rat heart tissues, mouse heart tissues
Positive IHC detected inhuman heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse heart tissue
Positive FC (Intra) detected inC2C12 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:150-1:600
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67533-1-Ig targets MYL4 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19244

Product name: Recombinant human MYL4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-197 aa of BC030228

Sequence: MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG

Predict reactive species
Full Name myosin, light chain 4, alkali; atrial, embryonic
Calculated Molecular Weight 197 aa, 22 kDa
Observed Molecular Weight 22-25 kDa
GenBank Accession NumberBC030228
Gene Symbol MYL4
Gene ID (NCBI) 4635
RRIDAB_2882752
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP12829
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Myosin light‐chain 4 (MYL4) encodes an essential myosin light chain that is expressed in embryonic whole heart and skeletal muscle. It is specifically expressed in human atria after birth. MYL4 is essential for atrial electrical, functional, and structural integrity, and MYL4 dysfunction can produce severe inherited atrial cardiomyopathy.

Protocols

Product Specific Protocols
FC protocol for MYL4 antibody 67533-1-IgDownload protocol
IF protocol for MYL4 antibody 67533-1-IgDownload protocol
IHC protocol for MYL4 antibody 67533-1-IgDownload protocol
WB protocol for MYL4 antibody 67533-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Front Cell Dev Biol

HiPS-Endothelial Cells Acquire Cardiac Endothelial Phenotype in Co-culture With hiPS-Cardiomyocytes.

Authors - Emmi Helle
ratWB

J Proteome Res

Data-Independent Acquisition Proteomics and N-Terminomics Methods Reveal Alterations in Mitochondrial Function and Metabolism in Ischemic-Reperfused Hearts

Authors - Bridgette Hartley
mouseWB,IF

Genes (Basel)

Molecular Mechanism of MYL4 Regulation of Skeletal Muscle Development in Pigs

Authors - Xueli Xu
  • KD Validated
pigWB

Gene

Haplotypes within the regulatory region of MYL4 are associated with pig muscle fiber size

Authors - Shixiong Dong
mouseWB

Cell Biosci

Motoneurons innervation determines the distinct gene expressions in multinucleated myofibers

Authors - Lei Bai
mouseIF

Front Med

Distinct mononuclear diploid cardiac subpopulation with minimal cell-cell communications persists in embryonic and adult mammalian heart

Authors - Miaomiao Zhu
Loading...
||
New chat Able
正在加载,请稍候...