MYL7 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 81570-1-RR (same clone as 81570-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 81570-1-RR (MYL7 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 81570-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 81570-1-RR (same clone as 81570-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 81570-1-RR (MYL7 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81570-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 81570-1-RR

  Biolayer interferometry (BLl) kinetic assays of 81570-1-RR against Human MYL7 were performed. The affinity constant is 0.25 nM.

MYL7 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 81570-1-PBS

Clone No.2C5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

2C5, MLC2a, MLC-2a, MYL2A, MYL7/MLC2a

---

Product Information

81570-1-PBS targets MYL7 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag11058

  Product name: Recombinant human MYL7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-175 aa of BC027915

  Sequence: MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE

• Full Name: myosin, light chain 7, regulatory
• Calculated Molecular Weight: 175 aa, 19 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC027915
• Gene Symbol: MYL7
• Gene ID (NCBI): 58498
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q01449
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MYL7, also known as myosin light chain 2a (MLC2a), is essential for heart development. The expression of MYL7 in heart is predominatantly restricted to the atrium. So its expression has been considered as useful marker for atrial cardiomyocytes.