MYLK2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MYLK2 Polyclonal antibody, PBS Only (21173-1-PBS)

• 

  WB analysis using 21173-1-AP (same clone as 21173-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21173-1-AP (MYLK2 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21173-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 21173-1-AP (same clone as 21173-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 21173-1-AP (MYLK2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21173-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human skeletal muscle using 21173-1-AP (same clone as 21173-1-PBS)

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 21173-1-AP (MYLK2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21173-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 21173-1-AP (same clone as 21173-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 21173-1-AP (MYLK2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21173-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 21173-1-AP (same clone as 21173-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 21173-1-AP (MYLK2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21173-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 21173-1-AP (same clone as 21173-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 21173-1-AP (MYLK2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21173-1-PBS in a different storage buffer formulation.

MYLK2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 21173-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

21173-1-PBS targets MYLK2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15424

  Product name: Recombinant human MYLK2 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-300 aa of BC069627

  Sequence: MATENGAVELGIQNPSTDKAPKGPTGERPLAAGKDPGPPDPKKAPDPPTLKKDAKAPASEKGDGTLAQPSTSSQGPKGEGDRGGGPAEGSAGPPAALPQQTATPETSVKKPKAEQGASGSQDPGKPRVGKKAAEGQAAARRGSPAFLHSPSCPAIISSSEKLLAKKPPSEASELTFEGVPMTHSPTDPRPAKAEEGKNILAESQKEVGEKTPGQAGQAKMQGDTSRGIEFQAVPSEKSEVGQALCLTAREEDCFQILDDCPPPPAPFPHRMVELRTGNVSSEFSMNSKEALGGGKFGAVC

• Full Name: myosin light chain kinase 2
• Calculated Molecular Weight: 596 aa, 65 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC069627
• Gene Symbol: MYLK2
• Gene ID (NCBI): 85366
• RRID: AB_10733123
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H1R3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MYLK2, also named as MLCK2, belongs to the protein kinase superfamily and CAMK Ser/Thr protein kinase family. MYLK2 catalyze the reaction: ATP + [myosin light-chain] = ADP + [myosin light-chain] phosphate. MYLK2 is implicated in the level of global muscle contraction and cardiac function. MYLK2 phosphorylates a specific serine in the N-terminus of a myosin light chain. Mutation of MYLK2 will cause the cardiomyopathy familial hypertrophic (CMH).