MYO1F Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MYO1F Polyclonal antibody, PBS Only (28841-1-PBS)

• 

  WB analysis using 28841-1-AP (same clone as 28841-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28841-1-AP (MYO1F antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28841-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 28841-1-AP (same clone as 28841-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 28841-1-AP (MYO1F antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28841-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 28841-1-AP (same clone as 28841-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 28841-1-AP (MYO1F antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28841-1-PBS in a different storage buffer formulation.

• 

  IF Staining of THP-1 using 28841-1-AP (same clone as 28841-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using MYO1F antibody (28841-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 28841-1-PBS in a different storage buffer formulation.

MYO1F Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 28841-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Myosin Ie, myosin IF, Myosin-Ie, Unconventional myosin-If

---

Product Information

28841-1-PBS targets MYO1F in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29899

  Product name: Recombinant human MYO1F protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 198-276 aa of BC028071

  Sequence: VMQNENERNFHIYYQLLEGASQEQRQNLGLMTPDYYYYLNQSDTYQVDGTDDRSDFGETLSAMQVIGIPPSIQQLVLQL

• Full Name: myosin IF
• Calculated Molecular Weight: 1098 aa, 125 kDa
• Observed Molecular Weight: 115-125 kDa
• GenBank Accession Number: BC028071
• Gene Symbol: MYO1F
• Gene ID (NCBI): 4542
• RRID: AB_3669671
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00160
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Myosin family members are proteins that hydrolyze ATP to generate force or directional movement along actin filaments and are implicated in the rearrangement of the cytoskeleton in several cell types. Myosin 1F (MYO1F), a long tailed class I myosin, is highly expressed in natural killer (NK) cells, macrophages, dendritic cells, and neutrophils. MYO1F plays a critical role in the mediating of signaling molecules "trafficking from membrane to cytoplasm," and this process is essential for the antifungal signaling pathway activation.