CoraLite® Plus 488-conjugated MYO1G Recombinant monoclonal antibody

MYO1G Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-83556-5
Clone No.240503E1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

240503E1, HA 2, Minor histocompatibility antigen HA-2, myosin IG, Unconventional myosin-Ig

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inJurkat cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83556-5 targets MYO1G in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag22698

Product name: Recombinant human MYO1G protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 190-391 aa of BC113544

Sequence: RVLKQHVGERNFHAFYQLLRGSEDKQLHELHLERNPAVYNFTHQGAGLNMTVHSALDSDEQSHQAVTEAMRVIGFSPEEVESVHRILAAILHLGNIEFVETEEGGLQKEGLAVAEEALVDHVAELTATPRDLVLRSLLARTVASGGRELIEKGHTAAEASYARDACAKAVYQRLFEWVVNRINSVMEPRGRDPRRDGKDTVI

Predict reactive species
Full Name myosin IG
Calculated Molecular Weight 1018 aa, 116 kDa
Observed Molecular Weight110-120 kDa
GenBank Accession NumberBC113544
Gene Symbol MYO1G
Gene ID (NCBI) 64005
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDB0I1T2
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

MYO1G is a plasma membrane-associated class I myosin that is abundant in T and B lymphocytes and mast cells and expressed specifically in the haematopoietic system. Class I myosins have been implicated in various cellular processes relying on actin-dependent membrane dynamics such as endocytosis, secretion, adhesion, motility and regulation of mechanosensitive channels (PMID: 19968988). MYO1G localizes to the plasma membrane linked to PIP2 and PIP3, is particularly enriched at cell-surface microvilli, and associates in an ATP-releasable manner to the actin cytoskeleton (PMID: 24310084). MYO1G can be detected as about 110-120 kDa.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 MYO1G antibody CL488-83556-5Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...