MYOM2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MYOM2 Polyclonal antibody, PBS Only (32262-1-PBS)

• 

  WB analysis using 32262-1-AP (same clone as 32262-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32262-1-AP (MYOM2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32262-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 32262-1-AP (same clone as 32262-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 32262-1-AP (MYOM2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32262-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 32262-1-AP (same clone as 32262-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 32262-1-AP (MYOM2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32262-1-PBS in a different storage buffer formulation.

MYOM2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 32262-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Myomesin-2, Myomesin family member 2, M-protein, 165 kDa titin-associated protein, 165 kDa connectin-associated protein

---

Product Information

32262-1-PBS targets MYOM2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35659

  Product name: Recombinant human MYOM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of NM_003970.3

  Sequence: MSLVTVPFYQKRHRHFDQSYRNIQTRYLLDEYASKKRASTQASSQKSLSQRSSSQRASSQTSLGGTICRVCAKRVSTQEDEEQENRSRYQSLVAAYGEAKRQRFLSELAHLEEDVHLARSQARDKLDKYAIQQMMEDKLAWERHTFEERISRAPEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEP

• Full Name: myomesin (M-protein) 2, 165kDa
• Calculated Molecular Weight: 165kDa，1465aa
• Observed Molecular Weight: 165 kDa
• GenBank Accession Number: NM_003970.3
• Gene Symbol: MYOM2
• Gene ID (NCBI): 9172
• RRID: AB_3742556
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P54296
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Myomesin proteins comprise three family members encoded by MYOM1, MYOM2 and MYOM3, and localize to the M-band of the sarcomere. These three myomesin isoforms correlate with the contractile properties in different fiber types. MYOM1 is expressed in all striated muscles, whereas MYOM2 is expressed in the adult heart and fast fibers, and MYOM3 is expressed only in skeletal muscle intermediate fiber types (PMID:14609030;26792323;15890201).