MYOM3 Polyclonal antibody, PBS Only

• 

  WB analysis using 17692-1-AP (same clone as 17692-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17692-1-AP (MYOM3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17692-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 17692-1-AP (same clone as 17692-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 17692-1-AP (MYOM3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17692-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 17692-1-AP (same clone as 17692-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 17692-1-AP (MYOM3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17692-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse skeletal muscle using 17692-1-AP (same clone as 17692-1-PBS)

  IP result of anti-MYOM3 (IP:17692-1-AP, 4ug; Detection:17692-1-AP 1:1000) with mouse skeletal muscle tissue lysate 1280 ug. This data was developed using the same antibody clone with 17692-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 17692-1-AP (same clone as 17692-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 17692-1-AP (MYOM3 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 17692-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 17692-1-AP (same clone as 17692-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 17692-1-AP (MYOM3 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 17692-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 17692-1-AP (same clone as 17692-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 17692-1-AP (MYOM3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17692-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 17692-1-AP (same clone as 17692-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 17692-1-AP (MYOM3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17692-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse skeletal muscle using 17692-1-AP (same clone as 17692-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse skeletal muscle tissue using MYOM3 antibody (17692-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 17692-1-PBS in a different storage buffer formulation.

MYOM3 Polyclonal Antibody for WB, IHC, IF-P, IP, Indirect ELISA

Cat No. 17692-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, Indirect ELISA

Synonyms

Myomesin 3, Myomesin family member 3, Myomesin-3

---

Product Information

17692-1-PBS targets MYOM3 in WB, IHC, IF-P, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11849

  Product name: Recombinant human MYOM3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 888-1213 aa of BC067101

  Sequence: SMPTDPVLLEDKPGAHEIEVGVDEEGFIYLAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDDDFDKLLRKADAKRRDWKRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMPDGQYDPETGTGLLCIEEASVAPASGLTFSFGCKPGRAKSSGLGVRAGPRLG

• Full Name: myomesin family, member 3
• Calculated Molecular Weight: 162 kDa, 136 kDa
• Observed Molecular Weight: 162 kDa
• GenBank Accession Number: BC067101
• Gene Symbol: MYOM3
• Gene ID (NCBI): 127294
• RRID: AB_2146624
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5VTT5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MYOM3 (myomesin 3) is a structural component of the M-band in striated muscle and is involved in sarcomere stability and resistance during intense or sustained stretching. MYOM3 can be detected mainly in intermediate-speed fibers of skeletal muscle. Recently high levels of MYOM3 fragments were detected in sera from patients with muscular dystrophy, including Duchenne muscular dystrophy (DMD). MYOM3 fragments may be used as serum biomarkers for DMD and other neuromuscular disorders. This antibody recognizes the intact MYOM3 protein (160-162 kDa) as well as MYOM3 fragments (100 kDa and 130 kDa). (26060189)