MYOT Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MYOT Polyclonal antibody, PBS Only (10731-1-PBS)

• 

  WB analysis of mouse skeletal muscle using 10731-1-AP (same clone as 10731-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 10731-1-AP (MYOT antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10731-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 10731-1-AP (same clone as 10731-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 10731-1-AP (MYOT antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10731-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 10731-1-AP (same clone as 10731-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 10731-1-AP (MYOT antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10731-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 10731-1-AP (same clone as 10731-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 10731-1-AP (MYOT antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10731-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 10731-1-AP (same clone as 10731-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 10731-1-AP (MYOT antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10731-1-PBS in a different storage buffer formulation.

MYOT Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 10731-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

10731-1-PBS targets MYOT in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1112

  Product name: Recombinant human MYOT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 191-498 aa of BC005376

  Sequence: GPQNAAAVFQAQDDSGAQDSQQHNSEHARLQVPTSQVRSRSTSRGDVNDQDAIQEKFYPPRFIQVPENMSIDEGRFCRMDFKVSGLPAPDVSWYLNGRTVQSDDLHKMIVSEKGLHSLIFEVVRASDAGAYACVAKNRAGEATFTVQLDVLAKEHKRAPMFIYKPQSKKVLEGDSVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLYQDNTGRVTLLIKDVNKKDAGWYTVSAVNEAGVTTCNTRLDVTARPNQTLPAPKQLRVRPTFSKYLALNGKGLNVKQAFNPEGEFQRLAAQSGLYESEEL

• Full Name: myotilin
• Calculated Molecular Weight: 55 kDa
• Observed Molecular Weight: 55-57 kDa, 35 kDa
• GenBank Accession Number: BC005376
• Gene Symbol: MYOT
• Gene ID (NCBI): 9499
• RRID: AB_2297956
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UBF9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MYOT (myotilin) is a structural protein of the striated muscle Z-discs. It interacts with both actinin and filamin, forming a complex to maintain structural stability of muscles. In adult tissues, myotilin is mainly expressed in skeletal and cardiac muscles and in the peripheral nerves. Missense mutations of myotilin cause limb girdle muscular dystrophy 1A and some other myopathy. Two isoforms of MYOT exist due to the alternative splicing. This antibody can detect both of isoforms around 57 kDa and 35 kDa.