Filter: AllWBIF/ICCAffinity

WB analysis using 86963-1-RR (same clone as 86963-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 86963-1-RR (MYST3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86963-1-PBS in a different storage buffer formulation.
IF Staining of MCF-7 using 86963-1-RR (same clone as 86963-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using MYST3 antibody (86963-1-RR, Clone: 251927F2 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86963-1-PBS in a different storage buffer formulation.
Affinity of 86963-1-RR
Biolayer interferometry (BLl) kinetic assays of 86963-1-RR against Human MYST3 were performed. The affinity constant is 0.275 nM.

MYST3 Recombinant monoclonal antibody, PBS Only

Name: MYST3 Recombinant monoclonal antibody, PBS Only
Brand: Proteintech
SKU: 86963-1-PBS

MYST3 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86963-1-PBS

Clone No.251927F2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

KAT6A, MOZ, MYST 3, RUNXBP2, Zinc finger protein 220

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

86963-1-PBS targets MYST3 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag29729 Product name: Recombinant human MYST3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 420-510 aa of BC142659 Sequence: SPDGRKARGEVVDYSEQYRIRKRGNRKSSTSDWPTDNQDGWDGKQENEERLFGSQEIMTEKDMELFRDIQEQALQKVGVTGPPDPQVRCPS Predict reactive species
Full Name	MYST histone acetyltransferase (monocytic leukemia) 3
Calculated Molecular Weight	2004 aa, 225 kDa
Observed Molecular Weight	310 kDa
GenBank Accession Number	BC142659
Gene Symbol	MYST3
Gene ID (NCBI)	7994
RRID	AB_3745237
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q92794
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™