Tested Applications
| Positive WB detected in | MCF-10A cells, BT-474 cells |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
86963-1-RR targets MYST3 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag29729 Product name: Recombinant human MYST3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 420-510 aa of BC142659 Sequence: SPDGRKARGEVVDYSEQYRIRKRGNRKSSTSDWPTDNQDGWDGKQENEERLFGSQEIMTEKDMELFRDIQEQALQKVGVTGPPDPQVRCPS Predict reactive species |
| Full Name | MYST histone acetyltransferase (monocytic leukemia) 3 |
| Calculated Molecular Weight | 2004 aa, 225 kDa |
| Observed Molecular Weight | 310 kDa |
| GenBank Accession Number | BC142659 |
| Gene Symbol | MYST3 |
| Gene ID (NCBI) | 7994 |
| RRID | AB_3745237 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q92794 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MYST3 antibody 86963-1-RR | Download protocol |
| WB protocol for MYST3 antibody 86963-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





