Home
Products
Primary Antibodies
Mammaglobin B Polyclonal antibody, PBS Only (21211-1-PBS)

Filter: AllIHC

IHC staining of human ovary tumor using 21211-1-AP (same clone as 21211-1-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 21211-1-AP (Mammaglobin B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21211-1-PBS in a different storage buffer formulation.
IHC staining of human ovary tumor using 21211-1-AP (same clone as 21211-1-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 21211-1-AP (Mammaglobin B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21211-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 21211-1-AP (same clone as 21211-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 21211-1-AP (Mammaglobin B antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21211-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 21211-1-AP (same clone as 21211-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 21211-1-AP (Mammaglobin B antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21211-1-PBS in a different storage buffer formulation.

Mammaglobin B Polyclonal antibody, PBS Only

Name: Mammaglobin B Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 21211-1-PBS

Mammaglobin B Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 21211-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

21211-1-PBS targets Mammaglobin B in IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag15609 Product name: Recombinant human Mammaglobin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 50-95 aa of BC062218 Sequence: IDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMKSN Predict reactive species
Full Name	secretoglobin, family 2A, member 1
Calculated Molecular Weight	95 aa, 11 kDa
GenBank Accession Number	BC062218
Gene Symbol	Mammaglobin B
Gene ID (NCBI)	4246
RRID	AB_3085644
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O75556
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Mammaglobin B, also referred to as secretoglobin family 2A member 1 (SCGB2A1), is a member of the uteroglobin superfamily. SCGB2A1 has been identified as a candidate biomarker for the detection of lymph node micrometastases in breast cancer and abdominal cancer types. SCGB2A1 has been considered as a promising diagnostic marker for occult tumor cells in effusions of several malignancies and as a potential immunotherapeutic target in ovarian cancer.