Filter: AllWBIHC

WB analysis using 25560-1-AP (same clone as 25560-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 25560-1-AP (Marapsin2/PRSS38 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25560-1-PBS in a different storage buffer formulation.
IHC staining of mouse testis using 25560-1-AP (same clone as 25560-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 25560-1-AP (MPN2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25560-1-PBS in a different storage buffer formulation.

Marapsin2/PRSS38 Polyclonal antibody, PBS Only

Name: Marapsin2/PRSS38 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 25560-1-PBS

Marapsin2/PRSS38 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 25560-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

MPN2, marapsin-2, PRSS38

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

25560-1-PBS targets Marapsin2/PRSS38 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag22191 Product name: Recombinant human MPN2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 110-225 aa of BC130400 Sequence: IYDMYVGLVNLRVDGNHTQWYEVNRVILHPTYEMYHPIGGDVALVQLKTRIVFSESVLPVCLATPEVNLTSANCWATGWGLVSKQGETSDELQEVQLPLILEPWCHLLYGHMSYIM Predict reactive species
Full Name	marapsin 2
Calculated Molecular Weight	326 aa, 35 kDa
Observed Molecular Weight	35 kDa
GenBank Accession Number	BC130400
Gene Symbol	MPN2
Gene ID (NCBI)	339501
RRID	AB_3742151
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	A1L453
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

PRSS38, also known as Marapsin-2, belongs to the peptidase S1 family and is expressed specifically in the testis.

Able™