Maturin Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Maturin Polyclonal antibody, PBS Only (27936-1-PBS)

• 

  WB analysis using 27936-1-AP (same clone as 27936-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27936-1-AP (Maturin antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27936-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 27936-1-AP (same clone as 27936-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27936-1-AP (Maturin antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27936-1-PBS in a different storage buffer formulation.

Maturin Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27936-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

27936-1-PBS targets Maturin in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19932

  Product name: Recombinant human C7orf41 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-131 aa of BC156839

  Sequence: MDFQQLADVAEKWCSNTPFELIATEETERRMDFYADPGVSFYVLCPDNGCGDNFHVWSESEDCLPFLQLAQDYISSCGKKTLHEVLEKVFKSFRPLLGLPDADDDAFEEYSADVEEEEPEADHPQMGVSQQ

• Full Name: chromosome 7 open reading frame 41
• Calculated Molecular Weight: 131 aa, 15 kDa
• Observed Molecular Weight: 14-17 kDa
• GenBank Accession Number: BC156839
• Gene Symbol: Maturin
• Gene ID (NCBI): 222166
• RRID: AB_3086012
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N3F0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.