Mitoferrin 1 Polyclonal antibody

• 

  WB analysis using 26469-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26469-1-AP (Mitoferrin 1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 26469-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 26469-1-AP (Mitoferrin 1 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human liver using 26469-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 26469-1-AP (Mitoferrin 1 antibody) at dilution of 1:200 (under 40x lens).

Mitoferrin 1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26469-1-AP

Publications(21)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

MFRN, Mfrn1, Mitochondrial iron transporter 1, Mitoferrin 1, MSC, MSCP, SLC25A37

---

Tested Applications

• Positive WB detected in: L02 cells, mouse liver tissue, mouse spleen tissue, rat spleen tissue
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 18 publications below
• IHC: See 2 publications below
• IF: See 1 publications below

Product Information

26469-1-AP targets Mitoferrin 1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24876

  Product name: Recombinant human SLC25A37 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-44 aa of BC132799

  Sequence: MELRSGSVGSQAVARRMDGDSRDGGGGKDATGSEDYENLPTSAS

• Full Name: solute carrier family 25, member 37
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC132799
• Gene Symbol: Mitoferrin 1
• Gene ID (NCBI): 51312
• RRID: AB_2880527
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NYZ2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Redox Biol; Mitochondrial ferritin alleviates apoptosis by enhancing mitochondrial bioenergetics and stimulating glucose metabolism in cerebral ischemia reperfusion; Authors - Peina Wang
human	WB	Cell Death Dis; Ferroptosis triggers mitochondrial fragmentation via Drp1 activation; Authors - Lohans Pedrera
mouse	WB	Biomed Pharmacother; The roles and mechanisms of CDGSH iron-sulfur domain 1 in kainic acid-induced mitochondrial iron overload, dysfunction and neuronal damage; Authors - Jing Wang
human	WB	Int J Mol Sci; Contemporary Antiretroviral Therapy Dysregulates Iron Transport and Augments Mitochondrial Dysfunction in HIV-Infected Human Microglia and Neural-Lineage Cells; Authors - Harpreet Kaur
human,rat	WB	J Neurochem; Cell density impacts the susceptibility to ferroptosis by modulating IRP1-mediated iron homeostasis; Authors - Hong-Fa Yan
human	WB	Sci Rep; Imbalance of redox homeostasis and altered cellular signaling induced by the metal complexes of terpyridine; Authors - Katarzyna Malarz

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Rahul (Verified Customer) (07-23-2025)

Works well to detect Mitoferrin1 even with a couple thousand cells (pretty sensitive).

• Applications: Western Blot
• Primary Antibody Dilution: 1:3000
• Cell Tissue Type: Hudep2

Mitoferrin 1 Antibody Western Blot validation (1:3000 dilution) in Hudep2 (Cat no:26469-1-AP)