Tested Applications
| Positive WB detected in | L02 cells, mouse liver tissue, mouse spleen tissue, rat spleen tissue |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 20 publications below |
| IHC | See 2 publications below |
| IF | See 1 publications below |
Product Information
26469-1-AP targets Mitoferrin 1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24876 Product name: Recombinant human SLC25A37 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-44 aa of BC132799 Sequence: MELRSGSVGSQAVARRMDGDSRDGGGGKDATGSEDYENLPTSAS Predict reactive species |
| Full Name | solute carrier family 25, member 37 |
| Observed Molecular Weight | 37 kDa |
| GenBank Accession Number | BC132799 |
| Gene Symbol | Mitoferrin 1 |
| Gene ID (NCBI) | 51312 |
| RRID | AB_2880527 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NYZ2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Mitoferrin 1 antibody 26469-1-AP | Download protocol |
| WB protocol for Mitoferrin 1 antibody 26469-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Redox Biol Mitochondrial ferritin alleviates apoptosis by enhancing mitochondrial bioenergetics and stimulating glucose metabolism in cerebral ischemia reperfusion | ||
Biomed Pharmacother The roles and mechanisms of CDGSH iron-sulfur domain 1 in kainic acid-induced mitochondrial iron overload, dysfunction and neuronal damage | ||
Int J Mol Sci Contemporary Antiretroviral Therapy Dysregulates Iron Transport and Augments Mitochondrial Dysfunction in HIV-Infected Human Microglia and Neural-Lineage Cells | ||
J Neurochem Cell density impacts the susceptibility to ferroptosis by modulating IRP1-mediated iron homeostasis | ||
Sci Rep Imbalance of redox homeostasis and altered cellular signaling induced by the metal complexes of terpyridine |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Rahul (Verified Customer) (07-23-2025) | Works well to detect Mitoferrin1 even with a couple thousand cells (pretty sensitive).
![]() |






