Tested Applications
| Positive WB detected in | L02 cells, mouse liver tissue, mouse spleen tissue, rat spleen tissue |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26469-1-AP targets Mitoferrin 1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24876 Product name: Recombinant human SLC25A37 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-44 aa of BC132799 Sequence: MELRSGSVGSQAVARRMDGDSRDGGGGKDATGSEDYENLPTSAS Predict reactive species |
| Full Name | solute carrier family 25, member 37 |
| Observed Molecular Weight | 37 kDa |
| GenBank Accession Number | BC132799 |
| Gene Symbol | Mitoferrin 1 |
| Gene ID (NCBI) | 51312 |
| RRID | AB_2880527 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NYZ2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Mitoferrin 1 antibody 26469-1-AP | Download protocol |
| WB protocol for Mitoferrin 1 antibody 26469-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Mitoferrin 1 polyclonal antibody (Cat# 26469-1-AP) has 26 total citations across 23 journals, including Nature Cancer, Nature Metabolism, Nature Cell Biology, Molecular Cell, Nature Chemical Biology, Autophagy, Redox Biology, Genome Medicine, and PLoS Genetics. Research fields encompass ferroptosis, mitochondrial iron metabolism, cancer biology, redox homeostasis, heme biosynthesis, and neurodegeneration. Cited applications include Western blot, immunohistochemistry, and immunofluorescence in human, mouse, and rat.
| Species | Application | Title |
|---|---|---|
Nat Cancer ENO1 suppresses cancer cell ferroptosis by degrading the mRNA of iron regulatory protein 1. | ||
Nat Metab BDH2-driven lysosome-to-mitochondria iron transfer shapes ferroptosis vulnerability of the melanoma cell states
| ||
Autophagy PINK1-deficiency facilitates mitochondrial iron accumulation and colon tumorigenesis | ||
Redox Biol FoxO1 regulates adipose transdifferentiation and iron influx by mediating Tgfβ1 signaling pathway | ||
Redox Biol Mitochondrial ferritin alleviates apoptosis by enhancing mitochondrial bioenergetics and stimulating glucose metabolism in cerebral ischemia reperfusion |
Reviews
What customers say
One reviewer rated this antibody 5 stars, using it at a 1:3000 dilution for Western Blot on Hudep2 cells. They reported that it works well to detect Mitoferrin1 and is quite sensitive, capable of detecting the target even with only a couple thousand cells. Overall, the feedback is positive, highlighting strong sensitivity and reliable performance in low-cell-number WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Rahul (Verified Customer) (07-23-2025) | Works well to detect Mitoferrin1 even with a couple thousand cells (pretty sensitive).
 |
