Moesin Monoclonal antibody, PBS Only (Capture)

• 

  Cytometric bead array standard curve of MP51280-2

  Cytometric bead array standard curve of MP51280-2, Moesin Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 60868-3-PBS. Detection antibody: 60868-2-PBS. Standard:Ag23543. Range: 1.563-100 ng/mL.

• 

  Cytometric bead array standard curve of MP51280-3

  Cytometric bead array standard curve of MP51280-3, Moesin Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 60868-3-PBS. Detection antibody: 60868-4-PBS. Standard:Ag23543. Range: 1.563-100 ng/mL.

• 

  Cytometric bead array standard curve of MP51280-4

  Cytometric bead array standard curve of MP51280-4, Moesin Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 60868-3-PBS. Detection antibody: 60868-5-PBS. Standard:Ag23543. Range: 1.563-100 ng/mL.

• 

  Affinity and Kinetic Characterization of 60868-3-PBS

  Biolayer interferometry (BLl) kinetic assays of 60868-3-Ig against Human Moesin were performed. The affinity constant is 9.85 nM.

Moesin Monoclonal Antibody for Cytometric bead array, Indirect ELISA

Cat No. 60868-3-PBS

Clone No.1A7F8

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

Membrane-organizing extension spike protein, MSN

---

Product Information

60868-3-PBS targets Moesin as part of a matched antibody pair:

MP51280-2: 60868-3-PBS capture and 60868-2-PBS detection (validated in Cytometric bead array)

MP51280-3: 60868-3-PBS capture and 60868-4-PBS detection (validated in Cytometric bead array)

MP51280-4: 60868-3-PBS capture and 60868-5-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23543

  Product name: Recombinant human MSN protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 385-502 aa of BC017293

  Sequence: EAEKLAKERQEAEEAKEALLQASRDQKKTQEQLALEMAELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQDEQDENGAEASADLRADAMAKD

• Full Name: moesin
• Calculated Molecular Weight: 577 aa, 68 kDa
• GenBank Accession Number: BC017293
• Gene Symbol: Moesin
• Gene ID (NCBI): 4478
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P26038
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.