MBP Polyclonal antibody, PBS Only

• 

  WB analysis using 10458-1-AP (same clone as 10458-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10458-1-AP (Myelin basic protein antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10458-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 10458-1-AP (same clone as 10458-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 10458-1-AP (Myelin basic protein antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10458-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 10458-1-AP (same clone as 10458-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 10458-1-AP (Myelin basic protein antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10458-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 10458-1-AP (same clone as 10458-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using Myelin basic protein antibody (10458-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 10458-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 10458-1-AP (same clone as 10458-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded mouse brain tissue using Myelin basic protein antibody (10458-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 10458-1-PBS in a different storage buffer formulation.

MBP Polyclonal Antibody for WB, IHC, IF-P, IF-Fro, ELISA

Cat No. 10458-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IF-Fro, ELISA

Synonyms

myelin basic protein

---

Product Information

10458-1-PBS targets MBP in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0713

  Product name: Recombinant human MBP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-171 aa of BC008749

  Sequence: MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARR

• Full Name: myelin basic protein
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 14-23 kDa
• GenBank Accession Number: BC008749
• Gene Symbol: Myelin basic protein
• Gene ID (NCBI): 4155
• RRID: AB_2250289
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P02686
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MBP belongs to the myelin basic protein family. The classic group of MBP isoforms (isoform 4-isoform 14) are the most abundant protein components of the myelin membrane in the CNS. They have a role in both its formation and stabilization. The smaller isoforms might have an important role in remyelination of denuded axons in multiple sclerosis. The non-classic group of MBP isoforms (isoform 1-isoform 3/Golli-MBPs) may preferentially have a role in the early developing brain long before myelination, maybe as components of transcriptional complexes, and may also be involved in signaling pathways in T-cells and neural cells. MBP has six isoforms. Catalog#10458-1-AP is capable of recognizing multiple isoforms of MBP.