Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
| Positive IF-Fro detected in | mouse brain tissue |
| Positive IF/ICC detected in | hiPSC |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10458-1-AP targets MBP in WB, IHC, IF/ICC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, rabbit |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0713 Product name: Recombinant human MBP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-171 aa of BC008749 Sequence: MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARR Predict reactive species |
| Full Name | myelin basic protein |
| Calculated Molecular Weight | 33 kDa |
| Observed Molecular Weight | 14-23 kDa |
| GenBank Accession Number | BC008749 |
| Gene Symbol | Myelin basic protein |
| Gene ID (NCBI) | 4155 |
| RRID | AB_2250289 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P02686 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MBP belongs to the myelin basic protein family. The classic group of MBP isoforms (isoform 4-isoform 14) are the most abundant protein components of the myelin membrane in the CNS. They have a role in both its formation and stabilization. The smaller isoforms might have an important role in remyelination of denuded axons in multiple sclerosis. The non-classic group of MBP isoforms (isoform 1-isoform 3/Golli-MBPs) may preferentially have a role in the early developing brain long before myelination, maybe as components of transcriptional complexes, and may also be involved in signaling pathways in T-cells and neural cells. MBP has six isoforms. Catalog#10458-1-AP is capable of recognizing multiple isoforms of MBP.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MBP antibody 10458-1-AP | Download protocol |
| IHC protocol for MBP antibody 10458-1-AP | Download protocol |
| WB protocol for MBP antibody 10458-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The MBP Polyclonal antibody (catalog number 10458-1-AP) has 221 total citations. These appear across numerous journals, including Cell, Nature Neuroscience, Nature Communications, Autophagy, ACS Nano, Journal of Neuroinflammation, Biomaterials, Neural Regeneration Research, Glia, Molecular Neurobiology, and Experimental Neurology. The research fields are predominantly neuroscience, focusing on myelin and oligodendrocyte biology, demyelination and remyelination, multiple sclerosis, spinal cord injury, neuroinflammation, peripheral nerve regeneration, stroke, and neurodegenerative diseases such as Alzheimer's and epilepsy.
| Species | Application | Title |
|---|---|---|
Cell Metab The foam cell-derived exosomes exacerbate ischemic white matter injury via transmitting metabolic defects to microglia | ||
Bioact Mater Engineered extracellular vesicles for delivery of siRNA promoting targeted repair of traumatic spinal cord injury | ||
Bioact Mater Construction of functional neural network tissue combining CBD-NT3-modified linear-ordered collagen scaffold and TrkC-modified iPSC-derived neural stem cells for spinal cord injury repair | ||
Nat Neurosci Lipid-accumulated reactive astrocytes promote disease progression in epilepsy | ||
Nat Neurosci Microglial TDP-43 mediates myelin refinement and represses Tyrobp cryptic exon inclusion in mice. |
Reviews
What customers say
All three reviews rated this MBP antibody 5 stars. Users reported successful performance in Western Blot and Immunofluorescence across human DRG tissue, mouse optic nerve, and rat brain. Key highlights include robust signal intensity, clear bands at expected isoform sizes, very low background with minimal off-target binding, and strong recognition of recombinant myelin protein. Recommended dilutions ranged from 1:200 (IF) to 1:5000 (WB). Overall, reviewers found the antibody reliable and specific for detecting myelin basic protein in both tissue and lysate applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Samantha (Verified Customer) (08-29-2025) | Used in a Western Blot and detected myelin in human dorsal root ganglia and bound to recombinant myelin protein
|
Kenzo (Verified Customer) (08-16-2023) | This MBP antibody worked well and generated robust immunofluorescence signals on mouse optic nerve sections.
|
Rebecca (Verified Customer) (02-10-2022) | Western performed on Biorad MiniPROTEAN 4-15% TGX precast gels and Precision Plus All Blue Protein Ladder and 4x Laemmli Sample Buffer. Blocking performed for 1h at room temperature using 5%BLOTTO. Primary antibody dilution was performed overnight at 4°C in 5%BLOTTO/0.05%Tween. Secondary antibody was LiCOR IRDye® 680RD Donkey anti-Mouse IgG (H + L) at 1:20000 dilution in PBS-Tween-SDS as per manufacturers instructions for 2h at room temperature. Blot showed clear bands of the expected isoform sizes with very low-none background/off target binding.
 |
