Myogenin Monoclonal antibody, PBS Only (Capture)

• 

  WB analysis of human skeletal muscle using 67082-1-Ig (same clone as 67082-1-PBS)

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 67082-1-Ig (Myogenin antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67082-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 67082-1-Ig (same clone as 67082-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 67082-1-Ig (Myogenin antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67082-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig heart using 67082-1-Ig (same clone as 67082-1-PBS)

  pig heart tissue were subjected to SDS PAGE followed by western blot with 67082-1-Ig (Myogenin antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67082-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat heart using 67082-1-Ig (same clone as 67082-1-PBS)

  rat heart tissue were subjected to SDS PAGE followed by western blot with 67082-1-Ig (Myogenin antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67082-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP51032-2

  Cytometric bead array standard curve of MP51032-2, Myogenin Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67082-1-PBS. Detection antibody: 67082-3-PBS. Standard:Ag6414. Range: 1.563-25 ng/mL.

• 

  Cytometric bead array standard curve of MP51032-3

  Cytometric bead array standard curve of MP51032-3, Myogenin Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67082-1-PBS. Detection antibody: 67082-4-PBS. Standard:Ag6414. Range: 1.563-100 ng/mL.

• 

  Affinity and Kinetic Characterization of 67082-1-Ig

  Biolayer interferometry (BLl) kinetic assay of 67082-1-Ig against Human Myogenin was performed. The affinity constant is below 1 pM...

Myogenin Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 67082-1-PBS

Clone No.1C10B9

Host / Isotype

Mouse / IgG1

Reactivity

human, rat, pig

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

MYOG, 1C10B9, bHLHc3, Class C basic helix-loop-helix protein 3, Myf 4

---

Product Information

67082-1-PBS targets Myogenin as part of a matched antibody pair:

MP51032-2: 67082-1-PBS capture and 67082-3-PBS detection (validated in Cytometric bead array)

MP51032-3: 67082-1-PBS capture and 67082-4-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6414

  Product name: Recombinant human Myogenin protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-224 aa of BC053899

  Sequence: MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEHCPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN

• Full Name: myogenin (myogenic factor 4)
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC053899
• Gene Symbol: Myogenin
• Gene ID (NCBI): 4656
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P15173
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MYOG (encoded Myogenin protein) is a muscle-specific transcription factor which belongs to a family of basic helix-loop-helix transcription factors. It plays a role in muscle differentiation, cell cycle exit and muscle atrophy(PMID: 30315160). It can be initiate the myogenic program in myoblasts, fiblasts and veritey of other cell types. Diseases associated with MYOG include Embryonal Rhabdomyosarcoma and Gallbladder Sarcoma.