Myogenin Monoclonal antibody, PBS Only (Capture)

Myogenin Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 67082-1-PBS
Clone No.1C10B9

Host / Isotype

Mouse / IgG1

Reactivity

human, rat, pig

Applications

WB, Cytometric bead array, Indirect ELISA

MYOG, 1C10B9, bHLHc3, Class C basic helix-loop-helix protein 3, Myf 4

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67082-1-PBS targets Myogenin as part of a matched antibody pair:

MP51032-2: 67082-1-PBS capture and 67082-3-PBS detection (validated in Cytometric bead array)

MP51032-3: 67082-1-PBS capture and 67082-4-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6414

Product name: Recombinant human Myogenin protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-224 aa of BC053899

Sequence: MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEHCPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN

Predict reactive species
Full Name myogenin (myogenic factor 4)
Calculated Molecular Weight 25 kDa
Observed Molecular Weight 26 kDa
GenBank Accession NumberBC053899
Gene Symbol Myogenin
Gene ID (NCBI) 4656
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP15173
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

MYOG (encoded Myogenin protein) is a muscle-specific transcription factor which belongs to a family of basic helix-loop-helix transcription factors. It plays a role in muscle differentiation, cell cycle exit and muscle atrophy(PMID: 30315160). It can be initiate the myogenic program in myoblasts, fiblasts and veritey of other cell types. Diseases associated with MYOG include Embryonal Rhabdomyosarcoma and Gallbladder Sarcoma.

Loading...
||
New chat Able
正在加载,请稍候...