N6AMT2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• N6AMT2 Polyclonal antibody, PBS Only (16954-1-PBS)

• 

  WB analysis of human liver using 16954-1-AP (same clone as 16954-1-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 16954-1-AP (N6AMT2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16954-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 16954-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 16954-1-AP (N6AMT2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 16954-1-AP (same clone as 16954-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 16954-1-AP (N6AMT2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16954-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 16954-1-AP (same clone as 16954-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 16954-1-AP (N6AMT2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16954-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 16954-1-AP (same clone as 16954-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 16954-1-AP (N6AMT2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16954-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 16954-1-AP (same clone as 16954-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 16954-1-AP (N6AMT2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16954-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 16954-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 16954-1-AP (N6AMT2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

N6AMT2 Polyclonal Antibody for WB, ELISA

Cat No. 16954-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

EC:2.1.1.-, EEF1A lysine methyltransferase 1, eEF1A-KMT, EEF1AKMT1, ESP13

---

Product Information

16954-1-PBS targets N6AMT2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10589

  Product name: Recombinant human N6AMT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-214 aa of BC018091

  Sequence: MSDLEDDETPQLSAHALAALQEFYAEQKQQIEPGEDDKYNIGIIEENWQLSQFWYSQETALQLAQEAIAAVGEGGRIACVSAPSVYQKLRELCRENFSIYIFEYDKRFAMYGEEFIFYDYNNPLDLPERIAAHSFDIVIADPPYLSEECLRKTSETVKYLTRGKILLCTGAIMEEQAAELLGVKMCTFVPRHTRNLANEFRCYVNYDSGLDCGI

• Full Name: N-6 adenine-specific DNA methyltransferase 2 (putative)
• Calculated Molecular Weight: 214 aa, 25 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC018091
• Gene Symbol: N6AMT2
• Gene ID (NCBI): 221143
• RRID: AB_2282277
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WVE0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.