Use Able AI chat for product recommendations

CoraLite® Plus 488-conjugated NAC1 Recombinant monoclonal antibody

NAC1 Uni-rAb® Recombinant Antibody for IF/ICC

Cat No. CL488-85380-2
Clone No.242788E11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

NACC1, 242788E11, BEND8, BTB/POZ domain-containing protein 14B, BTBD14B

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85380-2 targets NAC1 in applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag6096

Product name: Recombinant human NACC1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 173-527 aa of BC055396

Sequence: SDSVQCMPVAKRLWDSGQKEAGGGGNGSRKMAKFSTPDLAANRPHQPPPPQQAPVVAAAQPAVAAGAGQPAGGVAAAGGVVSGPSTSERTSPGTSSAYTSDSPGSYHNEEDEEEDGGEEGMDEQYRQICNMYTMYSMMNVGQTAEKVEALPEQVAPESRNRIRVRQDLASLPAELINQIGNRCHPKLYDEGDPSEKLELVTGTNVYITRAQLMNCHVSAGTRHKVLLRRLLASFFDRNTLANSCGTGIRSSTNDPRRKPLDSRVLHAVKYYCQNFAPNFKESEMNAIAADMCTNARRVVRKSWMPKVKVLKAEDDAYTTFISETGKIEPDMMGVEHGFETASHEGEAGPSAEALQ

Predict reactive species
Full Name nucleus accumbens associated 1, BEN and BTB (POZ) domain containing
Calculated Molecular Weight 57 kDa
Observed Molecular Weight60-65 kDa
GenBank Accession NumberBC055396
Gene Symbol NACC1
Gene ID (NCBI) 112939
RRIDAB_3747755
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96RE7
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

NAC1, also named as BTBD14B and NACC1, belongs to the BTB/POZ family. NACC1 is a transcriptional repressor, which is amplified and overexpressed in various human cancers and plays critical roles in tumor development, progression, and drug resistance (PMID: 31101655). While NAC1 has been shown to repress the transcription of two tumor suppressors, Gadd45-g and Gadd45-g- interacting protein 1, scientists have found that NACC1 also plays an important role in nontranscriptional function, for example, it can act as a bridge for MAVS and TBK1 in RLR-mediated signaling (PMID: 31235549). The observed molecular weight is consistent with what has been described in the literature (PMID: 37533751).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 NAC1 antibody CL488-85380-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...