NAC1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NAC1 Polyclonal antibody (14551-1-AP)

• KD/KO Validated

NAC1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 14551-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

NACC1, BEND8, BTB/POZ domain-containing protein 14B, BTBD14B, NAC-1

• 

  WB analysis using 14551-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14551-1-AP (NAC1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 14551-1-AP

  WB result of NAC1 antibody (14551-1-AP; 1:800; incubated at room temperature for 1.5 hours) with sh-Control and sh-NAC1 transfected MCF-7 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of MCF-7 using 14551-1-AP

  IP result of anti-NAC1 (IP:14551-1-AP, 4ug; Detection:14551-1-AP 1:300) with MCF-7 cells lysate 3200ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse ovary using 14551-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 14551-1-AP (NAC1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse ovary using 14551-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 14551-1-AP (NAC1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 14551-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 14551-1-AP (NAC1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 14551-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 14551-1-AP (NAC1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse ovary using 14551-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 14551-1-AP (NAC1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 14551-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed MCF-7 cells using NAC1 antibody (14551-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NAC1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: LNCaP cells, MCF-7 cells
• Positive IP detected in: MCF-7 cells
• Positive IHC detected in: mouse ovary tissue, human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14551-1-AP targets NAC1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6096

  Product name: Recombinant human NACC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 173-527 aa of BC055396

  Sequence: SDSVQCMPVAKRLWDSGQKEAGGGGNGSRKMAKFSTPDLAANRPHQPPPPQQAPVVAAAQPAVAAGAGQPAGGVAAAGGVVSGPSTSERTSPGTSSAYTSDSPGSYHNEEDEEEDGGEEGMDEQYRQICNMYTMYSMMNVGQTAEKVEALPEQVAPESRNRIRVRQDLASLPAELINQIGNRCHPKLYDEGDPSEKLELVTGTNVYITRAQLMNCHVSAGTRHKVLLRRLLASFFDRNTLANSCGTGIRSSTNDPRRKPLDSRVLHAVKYYCQNFAPNFKESEMNAIAADMCTNARRVVRKSWMPKVKVLKAEDDAYTTFISETGKIEPDMMGVEHGFETASHEGEAGPSAEALQ

• Full Name: nucleus accumbens associated 1, BEN and BTB (POZ) domain containing
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 60-65 kDa
• GenBank Accession Number: BC055396
• Gene Symbol: NACC1
• Gene ID (NCBI): 112939
• RRID: AB_2918036
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96RE7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NACC1, also named as BTBD14B and NAC1, belongs to the BTB/POZ family. NACC1 is a transcriptional repressor, which is amplified and overexpressed in various human cancers and plays critical roles in tumor development, progression, and drug resistance (PMID: 31101655). NACC1 has 1 isoform with the molecular mass of 57 kDa. While NAC1 has been shown to repress the transcription of two tumor suppressors, Gadd45-g and Gadd45-g- interacting protein 1, scientists have found that NACC1 also plays an important role in nontranscriptional function, for example, it can act as a bridge for MAVS and TBK1 in RLR-mediated signaling (PMID: 31235549).

Publications

What published studies show

The NAC1 Polyclonal antibody (catalog number 14551-1-AP) has 3 total citations. These appear in three journals: Journal of Clinical and Translational Hepatology, Oncology Reports, and Genes & Genomics. The associated research fields focus on cancer biology, including hepatocellular carcinoma, mantle cell lymphoma, and breast cancer, with studies examining proliferation, migration, angiogenesis, and EMT pathways. All citations used the antibody for Western blot (WB) in human samples.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Clin Transl Hepatol; Exosome-transported circHDAC1_004 Promotes Proliferation, Migration, and Angiogenesis of Hepatocellular Carcinoma by the miR-361-3p/NACC1 Axis; Authors - Bin Xu
human	WB	Oncol Rep; lncRNA FOXP4‑AS1 predicts poor prognosis and accelerates the progression of mantle cell lymphoma through the miR‑423‑5p/NACC1 pathway.; Authors - Hong-Fang Tao
human	WB	Genes Genomics; ST6GALNAC1 promotes the invasion and migration of breast cancer cells via the EMT pathway; Authors - Yunzhao Luo