CoraLite® Plus 488-conjugated NAC1 Polyclonal antibody

NAC1 Polyclonal Antibody for IF/ICC
Cat No. CL488-14551

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

NACC1, Nucleus accumbens-associated protein 1, NAC-1, BTBD14B, BTB/POZ domain-containing protein 14B

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-14551 targets NAC1 in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6096

Product name: Recombinant human NACC1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 173-527 aa of BC055396

Sequence: SDSVQCMPVAKRLWDSGQKEAGGGGNGSRKMAKFSTPDLAANRPHQPPPPQQAPVVAAAQPAVAAGAGQPAGGVAAAGGVVSGPSTSERTSPGTSSAYTSDSPGSYHNEEDEEEDGGEEGMDEQYRQICNMYTMYSMMNVGQTAEKVEALPEQVAPESRNRIRVRQDLASLPAELINQIGNRCHPKLYDEGDPSEKLELVTGTNVYITRAQLMNCHVSAGTRHKVLLRRLLASFFDRNTLANSCGTGIRSSTNDPRRKPLDSRVLHAVKYYCQNFAPNFKESEMNAIAADMCTNARRVVRKSWMPKVKVLKAEDDAYTTFISETGKIEPDMMGVEHGFETASHEGEAGPSAEALQ

Predict reactive species
Full Name nucleus accumbens associated 1, BEN and BTB (POZ) domain containing
Calculated Molecular Weight 57 kDa
Observed Molecular Weight 60 kDa
GenBank Accession NumberBC055396
Gene Symbol NACC1
Gene ID (NCBI) 112939
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96RE7
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

NACC1, also named as BTBD14B and NAC1, belongs to the BTB/POZ family. NACC1 is a transcriptional repressor, which is amplified and overexpressed in various human cancers and plays critical roles in tumor development, progression, and drug resistance (PMID: 31101655). NACC1 has 1 isoform with the molecular mass of 57 kDa. While NAC1 has been shown to repress the transcription of two tumor suppressors, Gadd45-g and Gadd45-g- interacting protein 1, scientists have found that NACC1 also plays an important role in nontranscriptional function, for example, it can act as a bridge for MAVS and TBK1 in RLR-mediated signaling (PMID: 31235549).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 NAC1 antibody CL488-14551Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...