APPBP1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• APPBP1 Polyclonal antibody (14863-1-AP)

• Featured Product
• KD/KO Validated

APPBP1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 14863-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, monkey

Applications

WB, IHC, IP, ELISA

Synonyms

NAE1, Amyloid beta precursor protein-binding protein 1, 59 kDa, Amyloid protein-binding protein 1, APP BP1, APP-BP1

• 

  WB analysis using 14863-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14863-1-AP (APPBP1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human kidney using 14863-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 14863-1-AP (APPBP1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 14863-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 14863-1-AP (APPBP1 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 14863-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 14863-1-AP (APPBP1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse kidney using 14863-1-AP

  IP result of anti-APPBP1 (IP:14863-1-AP, 4ug; Detection:14863-1-AP 1:500) with mouse kidney tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse salivary gland using 14863-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse salivary gland tissue slide using 14863-1-AP (APPBP1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for APPBP1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: COS-7 cells, human brain tissue, human kidney tissue, mouse brain tissue, rat brain tissue
• Positive IP detected in: mouse kidney tissue
• Positive IHC detected in: mouse salivary gland tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14863-1-AP targets APPBP1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.

• Tested Reactivity: human, mouse, rat, monkey
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6672

  Product name: Recombinant human NAE1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 181-534 aa of BC000480

  Sequence: EDLRLDKPFPELREHFQSYDLDHMEKKDHSHTPWIVIIAKYLAQWYSETNGRIPKTYKEKEDFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDRCINITKQTPSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREKAKKDAAAVGNHVAKLLQSIGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDEIISSMDNPDNEIVLYLMLRAVDRFHKQQGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLSVMVKDDYVHEFCRYGAAEPHTIAAFLGGAAAQEVIKIITKQFVIFNNTYIYSGMSQTSATFQL

• Full Name: NEDD8 activating enzyme E1 subunit 1
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC000480
• Gene Symbol: NAE1/APPBP1
• Gene ID (NCBI): 8883
• RRID: AB_2251388
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13564
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The APPBP1 (NAE1) Polyclonal antibody (Cat# 14863-1-AP) has 4 citations published in Autophagy, PNAS, Apoptosis, and Heliyon. Research fields include osteoclastogenesis and ferroptosis, mitochondrial dysfunction and cell survival, hepatocellular carcinoma prognosis and immune efficacy, and nasopharyngeal carcinoma with radiotherapy resistance. Cited applications are WB and IHC in human samples.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Autophagy; Targeting NAE1 suppresses osteoclastogenesis via dual regulation of ferritinophagy and ACSL3-mediated ferroptosis.; Authors - Hongwei Xie
	WB	Proc Natl Acad Sci U S A; Polo-like kinases mediate cell survival in mitochondrial dysfunction.; Authors - Takumi Matsumoto ; KD Validated
human	WB	Apoptosis; Identifying Neddylation-modified features to assess prognosis and immune efficacy in hepatocellular carcinoma.; Authors - Zitao Liu
human	IHC	Heliyon; Dual role of targeting NAE1 in nasopharyngeal carcinoma: Antitumor effects yet inducing radiotherapy resistance; Authors - Qinsong Liu