NAGA Monoclonal antibody

• 

  WB analysis using 67684-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67684-1-Ig (NAGA antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

NAGA Monoclonal Antibody for WB, ELISA

Cat No. 67684-1-Ig

Clone No.2A5F3

Host / Isotype

Mouse / IgG2b

Reactivity

Human

Applications

WB, ELISA

Synonyms

Alpha galactosidase B, D22S674, GALB, NAGA

---

Tested Applications

• Positive WB detected in: U2OS cells, LNCaP cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67684-1-Ig targets NAGA in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7225

  Product name: Recombinant human NAGA protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 22-411 aa of BC000095

  Sequence: LLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVNYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIKNLEMSQQ

• Full Name: N-acetylgalactosaminidase, alpha-
• Calculated Molecular Weight: 47 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC000095
• Gene Symbol: NAGA
• Gene ID (NCBI): 4668
• RRID: AB_2882877
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P17050
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NAGA belongs to the glycosyl hydrolase 27 family. It removes terminal alpha-N-acetylgalactosamine residues from glycolipids and glycopeptides. It is required for the breakdown of glycolipids. Biosynthetic studies performed with cultured fibroblasts indicated that the human enzyme was synthesized as a 65 kDa glycosylated precursor which was processed to a mature 48-kDa lysosomal form; both the precursor and mature forms had high mannose type oligosaccharide chains, but only the precursor's mannose residues were phosphorylated. 90-117 kDa is a homodimer of NAGA.