NARG1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NARG1 Polyclonal antibody (23845-1-AP)

NARG1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 23845-1-AP

Reviews (3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

NMDA receptor-regulated protein 1, N-alpha-acetyltransferase 15, NatA auxiliary subunit, NAA15, N terminal acetyltransferase, Gastric cancer antigen Ga19

• 

  WB analysis of HeLa using 23845-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 23845-1-AP (NARG1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 23845-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 23845-1-AP (NARG1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 23845-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 23845-1-AP (NARG1 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 23845-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 23845-1-AP (NARG1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 23845-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed HeLa cells using 23845-1-AP (NARG1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells
• Positive IHC detected in: human stomach cancer tissue, mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23845-1-AP targets NARG1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20842

  Product name: Recombinant human NARG1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-350 aa of BC093928

  Sequence: MPAVSLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKKEEAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLLQIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKTQQTSPDKVDYEYSELLLYQNQVLREAGLYREALEHLCTYEKQICDKLAVEETKGELLLQLCRLEDAADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKYPRGLVPRRLPLNFLSGEKFKECLDKFLRMNFSKGCPPVFNTLRSLYKDKEKVAIIEELVVGYE

• Full Name: NMDA receptor regulated 1
• Calculated Molecular Weight: 866 aa, 101 kDa
• Observed Molecular Weight: 95-100 kDa
• GenBank Accession Number: BC093928
• Gene Symbol: NARG1
• Gene ID (NCBI): 80155
• RRID: AB_2879338
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q9BXJ9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NAA15 (N-alpha-acetyltransferase 15) is a subunit of both the NatA and NatE complexes, and its role is to position the catalytic subunits in close vicinity to the nascent polypeptides (PMID: 33557580). Human NAA15 encodes an 866 amino acid (~105 kDa) protein, NAA15, containing tetratricopeptide repeat domains and a putative bipartite nuclear localization signal (PMID: 29656860). NAA15 was implicated in human disease and loss-of-function NAA15 variants in large cohorts of patients with autism spectrum disorder and/or ID (PMID: 33103328).

Reviews

4.6 out of 5

3 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Nathalie (Verified Customer) (03-05-2026)

Works well (overnight cold room incubation)

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: HCT116 cell extract

Morgane (Verified Customer) (10-01-2025)

Migrates at expected size and clean signal

• Applications: Western Blot
• Primary Antibody Dilution: 1/1000
• Cell Tissue Type: HCT116

NARG1 Antibody Western Blot validation (1/1000 dilution) in HCT116 (Cat no:23845-1-AP)

Zehua (Verified Customer) (07-09-2018)

Samples from ProteinTech. Works very well.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: MCF-7