NARG1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NARG1 Polyclonal antibody, PBS Only (23845-1-PBS)

• 

  WB analysis of HeLa using 23845-1-AP (same clone as 23845-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 23845-1-AP (NARG1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23845-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 23845-1-AP (same clone as 23845-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 23845-1-AP (NARG1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23845-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 23845-1-AP (same clone as 23845-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 23845-1-AP (NARG1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23845-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 23845-1-AP (same clone as 23845-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 23845-1-AP (NARG1 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23845-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 23845-1-AP (same clone as 23845-1-PBS)

  Immunofluorescent analysis of (10% Formaldehyde) fixed HeLa cells using 23845-1-AP (NARG1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 23845-1-PBS in a different storage buffer formulation.

NARG1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 23845-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

23845-1-PBS targets NARG1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20842

  Product name: Recombinant human NARG1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-350 aa of BC093928

  Sequence: MPAVSLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKKEEAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLLQIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKTQQTSPDKVDYEYSELLLYQNQVLREAGLYREALEHLCTYEKQICDKLAVEETKGELLLQLCRLEDAADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKYPRGLVPRRLPLNFLSGEKFKECLDKFLRMNFSKGCPPVFNTLRSLYKDKEKVAIIEELVVGYE

• Full Name: NMDA receptor regulated 1
• Calculated Molecular Weight: 866 aa, 101 kDa
• Observed Molecular Weight: 95-100 kDa
• GenBank Accession Number: BC093928
• Gene Symbol: NARG1
• Gene ID (NCBI): 80155
• RRID: AB_2879338
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q9BXJ9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NAA15 (N-alpha-acetyltransferase 15) is a subunit of both the NatA and NatE complexes, and its role is to position the catalytic subunits in close vicinity to the nascent polypeptides (PMID: 33557580). Human NAA15 encodes an 866 amino acid (~105 kDa) protein, NAA15, containing tetratricopeptide repeat domains and a putative bipartite nuclear localization signal (PMID: 29656860). NAA15 was implicated in human disease and loss-of-function NAA15 variants in large cohorts of patients with autism spectrum disorder and/or ID (PMID: 33103328).