NARS Monoclonal antibody

NARS Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 67711-1-Ig
Clone No.4G5G12

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

ASNRS, Asparagine tRNA ligase, asparaginyl tRNA synthetase, NARS, NARS1

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, HeLa cells, HepG2 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, RAW 264.7 cells
Positive IHC detected inhuman urothelial carcinoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:2000-1:8000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67711-1-Ig targets NARS in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6656

Product name: Recombinant human NARS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 199-548 aa of BC001687

Sequence: ELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTP

Predict reactive species
Full Name asparaginyl-tRNA synthetase
Calculated Molecular Weight 63 kDa
Observed Molecular Weight63 kDa
GenBank Accession NumberBC001687
Gene Symbol NARS
Gene ID (NCBI) 4677
RRIDAB_2882901
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO43776
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Asparagine-tRNA ligase (NARS) belongs to the class-II aminoacyl-tRNA synthetase family. Catalyzes the attachment of asparagine to tRNA(Asn) in a two-step reaction: asparagine is first activated by ATP to form Asn-AMP and then transferred to the acceptor end of tRNA(Asn) (PubMed: 9421509). In addition to its essential role in protein synthesis, acts as a signaling molecule that induced migration of CCR3-expressing cells. The NARS levels were higher in tumor tissues compared with adjacent normal tissues, and positively associated with LN metastasis. NARS may serve as a potential biomarker for lung adenocarcinoma (ADC) diagnosis/prognosis (PMID: 27161446).

Protocols

Product Specific Protocols
WB protocol for NARS antibody 67711-1-IgDownload protocol
IHC protocol for NARS antibody 67711-1-IgDownload protocol
IF protocol for NARS antibody 67711-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...