NARS Monoclonal antibody, PBS Only

NARS Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA
Cat No. 67711-1-PBS
Clone No.4G5G12

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

ASNRS, Asparagine tRNA ligase, asparaginyl tRNA synthetase, NARS, NARS1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67711-1-PBS targets NARS in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6656

Product name: Recombinant human NARS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 199-548 aa of BC001687

Sequence: ELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTP

Predict reactive species
Full Name asparaginyl-tRNA synthetase
Calculated Molecular Weight 63 kDa
Observed Molecular Weight63 kDa
GenBank Accession NumberBC001687
Gene Symbol NARS
Gene ID (NCBI) 4677
RRIDAB_2882901
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO43776
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Asparagine-tRNA ligase (NARS) belongs to the class-II aminoacyl-tRNA synthetase family. Catalyzes the attachment of asparagine to tRNA(Asn) in a two-step reaction: asparagine is first activated by ATP to form Asn-AMP and then transferred to the acceptor end of tRNA(Asn) (PubMed: 9421509). In addition to its essential role in protein synthesis, acts as a signaling molecule that induced migration of CCR3-expressing cells. The NARS levels were higher in tumor tissues compared with adjacent normal tissues, and positively associated with LN metastasis. NARS may serve as a potential biomarker for lung adenocarcinoma (ADC) diagnosis/prognosis (PMID: 27161446).

Loading...
||
New chat Able
正在加载,请稍候...