NARS Monoclonal antibody, PBS Only

• 

  WB analysis using 67711-1-Ig (same clone as 67711-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67711-1-Ig (NARS antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67711-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human urothelial carcinoma using 67711-1-Ig (same clone as 67711-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 67711-1-Ig (NARS antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67711-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67711-1-Ig (same clone as 67711-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using NARS antibody (67711-1-Ig, Clone: 4G5G12 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67711-1-PBS in a different storage buffer formulation.

NARS Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67711-1-PBS

Clone No.4G5G12

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

ASNRS, Asparagine tRNA ligase, asparaginyl tRNA synthetase, NARS, NARS1

---

Product Information

67711-1-PBS targets NARS in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6656

  Product name: Recombinant human NARS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 199-548 aa of BC001687

  Sequence: ELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTP

• Full Name: asparaginyl-tRNA synthetase
• Calculated Molecular Weight: 63 kDa
• Observed Molecular Weight: 63 kDa
• GenBank Accession Number: BC001687
• Gene Symbol: NARS
• Gene ID (NCBI): 4677
• RRID: AB_2882901
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O43776
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Asparagine-tRNA ligase (NARS) belongs to the class-II aminoacyl-tRNA synthetase family. Catalyzes the attachment of asparagine to tRNA(Asn) in a two-step reaction: asparagine is first activated by ATP to form Asn-AMP and then transferred to the acceptor end of tRNA(Asn) (PubMed: 9421509). In addition to its essential role in protein synthesis, acts as a signaling molecule that induced migration of CCR3-expressing cells. The NARS levels were higher in tumor tissues compared with adjacent normal tissues, and positively associated with LN metastasis. NARS may serve as a potential biomarker for lung adenocarcinoma (ADC) diagnosis/prognosis (PMID: 27161446).