NARS2 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• NARS2 Monoclonal antibody (60487-7-Ig)

• 

  WB analysis using 60487-7-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 60487-7-Ig (NARS2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

NARS2 Monoclonal Antibody for WB, ELISA

Cat No. 60487-7-Ig

Clone No.1G2H12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

AsnRS, Asparagine  tRNA ligase, Asparagine--tRNA ligase, mitochondrial, Asparaginyl-tRNA synthetase, EC:6.1.1.22

---

Tested Applications

• Positive WB detected in: LNCaP cells, Caco-2 cells, HeLa cells, HepG2 cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

60487-7-Ig targets NARS2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9326

  Product name: Recombinant human NARS2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 132-477 aa of BC007800

  Sequence: ERHPLEYLRQYPHFRCRTNVLGSILRIRSEATAAIHSFFKDSGFVHIHTPIITSNDSEGAGELFQLEPSGKLKVPEENFFNVPAFLTVSGQLHLEVMSGAFTQVFTFGPTFRAENSQSRRHLAEFYMIEAEISFVDSLQDLMQVIEELFKATTMMVLSKCPEDVELCHKFIAPGQKDRLEHMLKNNFLIISYTEAVEILKQASQNFTFTPEWGADLRTEHEKYLVKHCGNIPVFVINYPLTLKPFYMRDNEDGPQHTVAAVDLLVPGVGELFGGGLREERYHFLEERLARSGLTEVYQWYLDLRRFGSVPHGGFGMGFERYLQCILGVDNIKDVIPFPRFPHSCLL

• Full Name: asparaginyl-tRNA synthetase 2, mitochondrial (putative)
• Calculated Molecular Weight: 477 aa, 54 kDa
• Observed Molecular Weight: 50-54 kDa
• GenBank Accession Number: BC007800
• Gene Symbol: NARS2
• Gene ID (NCBI): 79731
• RRID: AB_3743218
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q96I59
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NARS2 (asparaginyl-tRNA synthetase 2, mitochondrial) is a nuclear-encoded enzyme that functions within the mitochondria, the energy-producing organelles of the cell. It belongs to the class II family of aminoacyl-tRNA synthetases (aaRSs), a group of essential enzymes responsible for protein synthesis. Its proper function is indispensable for mitochondrial protein synthesis and energy production, and its deficiency underlies a spectrum of severe human metabolic and neurological diseases.