NAS1/SLC13A1 Polyclonal antibody

• 

  WB analysis of HEK-293 using 25039-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 25039-1-AP (NAS1/SLC13A1 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 25039-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 25039-1-AP (NAS1/SLC13A1 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of mouse kidney using 25039-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse kidney tissue using NAS1/SLC13A1 antibody (25039-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse kidney using 25039-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse kidney tissue using NAS1/SLC13A1 antibody (25039-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

NAS1/SLC13A1 Polyclonal Antibody for WB, IF-P, ELISA

Cat No. 25039-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF-P, ELISA

Synonyms

SLC13A1, NAS1, hNaSi-1

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse kidney tissue
• Positive IF-P detected in: mouse kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25039-1-AP targets NAS1/SLC13A1 in WB, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19026

  Product name: Recombinant human SLC13A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 143-249 aa of BC148686

  Sequence: TAAMVMPIAEAVVQQIINAEAEVEATQMTYFNGSTNHGLEIDESVNGHEINERKEKTKPVPGYNNDTGKISSKVELEKNSGMRTKYRTKKGHVTRKLTCLCIAYSST

• Full Name: solute carrier family 13 (sodium/sulfate symporters), member 1
• Calculated Molecular Weight: 595 aa, 66 kDa
• Observed Molecular Weight: 66 kDa
• GenBank Accession Number: BC148686
• Gene Symbol: NAS1
• Gene ID (NCBI): 6561
• RRID: AB_2879864
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BZW2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC13A1 also known as NAS1, is an apical membrane Na(+)-sulfate cotransporter involved in sulfate homeostasis in the kidney. SLC13A1 primarily participates in pH-independent, sodium-dependent cotransport of sulfate across renal proximal tubules and small intestinal epithelia(PMID: 38552027).