NAT1 Polyclonal antibody

• 

  WB analysis of PC-3 using 19188-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 19188-1-AP (NAT1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 19188-1-AP

  WB result of NAT1 antibody (19188-1-AP; 1:800; incubated at room temperature for 1.5 hours) with sh-Control and sh-NAT1 transfected PC-3 cells.

• 

  WB analysis of A375 using 19188-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 19188-1-AP (NAT1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 19188-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 19188-1-AP (NAT1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 19188-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 19188-1-AP (NAT1 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human breast cancer using 19188-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 19188-1-AP (NAT1 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human breast cancer using 19188-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 19188-1-AP (NAT1 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human breast cancer using 19188-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 19188-1-AP (NAT1 antibody) at dilution of 1:100 (under 40x lens).

• 

  IF Staining of HeLa using 19188-1-AP

  Immunofluorescent analysis of Hela cells, using NAT1 antibody 19188-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye).

• 

  IF Staining of HepG2 using 19188-1-AP

  Immunofluorescent analysis of HepG2 cells, using NAT1 antibody 19188-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye).

• Featured Product
• KD/KO Validated

NAT1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 19188-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, CoIP, ELISA

Synonyms

Monomorphic arylamine N-acetyltransferase, MNAT, EC:2.3.1.5, Arylamine N-acetyltransferase 1, Arylamide acetylase 1

---

Tested Applications

• Positive WB detected in: PC-3 cells, human placenta tissue, A375 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: Hela cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• CoIP: See 1 publications below

Product Information

19188-1-AP targets NAT1 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6280

  Product name: Recombinant human NAT1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-290 aa of BC047666

  Sequence: MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYIVDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDLLEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI

• Full Name: N-acetyltransferase 1 (arylamine N-acetyltransferase)
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 32-34 kDa
• GenBank Accession Number: BC047666
• Gene Symbol: NAT1
• Gene ID (NCBI): 9
• RRID: AB_10641045
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P18440
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Oncol; Prognostic and Clinicopathological Significance of X-Box-Binding Protein 1 and N-Acetyltransferase 1 in Gallbladder Cancer.; Authors - Rushi Liu
human	WB,CoIP	Nucleic Acids Res; Integrated multi-omics approach revealed cellular senescence landscape; Authors - Qiao Song
Rat	WB	Int J Mol Sci; Hyperbaric Oxygen Therapy Alleviates Paclitaxel-Induced Peripheral Neuropathy Involving Suppressing TLR4-MyD88-NF-κB Signaling Pathway; Authors - Shih-Hung Wang