CoraLite® Plus 488-conjugated NAT10 Recombinant monoclonal antibody

NAT10 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra)
Cat No. CL488-82585
Clone No.5B9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

N acetyltransferase 10, KIAA1709, EC:2.3.1.-, ALP, 5B9

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82585 targets NAT10 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4184

Product name: Recombinant human NAT10 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 676-1025 aa of BC035558

Sequence: EAVSLLEEVITPRKDLPPLLLKLNERPAERLDYLGVSYGLTPRLLKFWKRAGFVPVYLRQTPNDLTGEHSCIMLKTLTDEDEADQGGWLAAFWKDFRRRFLALLSYQFSTFSPSLALNIIQNRNMGKPAQPALSREELEALFLPYDLKRLEMYSRNMVDYHLIMDMIPAISRIYFLNQLGDLALSAAQSALLLGIGLQHKSVDQLEKEIELPSGQLMGLFNRIIRKVVKLFNEVQEKAIEEQMVAAKDVVMEPTMKTLSDDLDEAAKEFQEKHKKEVGKLKSMDLSEYIIRGDDEEWNEVLNKAGPNASIISLKSDKKRKLEAKQEPKQSKKLKNRETKNKKDMKLKRKK

Predict reactive species
Full Name N-acetyltransferase 10 (GCN5-related)
Calculated Molecular Weight 1025 aa, 116 kDa
Observed Molecular Weight 116 kDa
GenBank Accession NumberBC035558
Gene Symbol NAT10
Gene ID (NCBI) 55226
RRIDAB_3084515
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9H0A0
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

NAT10 (N-acetyltransferase 10) is a nucleolar protein that is involved in regulation of telomerase activity, DNA damage response, and cytokinesis. It also plays a role in maintaining nuclear shape. Inhibition of NAT10 has been reported to rescue the misshapen nuclei in laminopathic cells via microtubule reorganization. The specificity of this antibody has been tested by siRNA (PMID: 24786082). NAT10 regulates mitotic cell fate by acetylating Eg5. NAT10 depletion results in multinuclear giant cells, which is the hallmark of mitotic catastrophe (PMID: 35210604). NAT10 plays a crucial role in carcinogenesis through influencing EMT, hypoxia, ribosomal biogenesis and overall, promoting translational efficiency. Recently, we reported that treating cancer cells with Remodelin, a small molecule inhibitor of NAT10, causes alteration in global lipid metabolism (PMID: 36149760).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 NAT10 antibody CL488-82585Download protocol
IF protocol for CL Plus 488 NAT10 antibody CL488-82585Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...