NAT8L Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87576-1-RR (same clone as 87576-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87576-1-RR (NAT8L antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87576-1-PBS in a different storage buffer formulation.

NAT8L Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87576-1-PBS

Clone No.252994C9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Camello like protein 3, Camello-like protein 3, CML3, EC:2.3.1.17, Hcml3

---

Product Information

87576-1-PBS targets NAT8L in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34067

  Product name: Recombinant human NAT8L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-134 aa of BC103748

  Sequence: MADIEQYYMKPPGSCFWVAVLDGNVVGIVAARAHEEDNTVELLRMSVDSRFRGKGIAKALGRKVLEFAVVHNYSAVVLGTTAVKVAAHKLYESLGFRHMGASDHYVLPGMTLSLAERLFFQVRYHRYRLQLREE

• Full Name: N-acetyltransferase 8-like (GCN5-related, putative)
• Calculated Molecular Weight: 134 aa, 15 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC103748
• Gene Symbol: NAT8L
• Gene ID (NCBI): 339983
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8N9F0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NAT8L (N-acetyltransferase 8-like) catalyzes the formation of N-acetyl aspartate (NAA) from acetyl-CoA and aspartate. In the brain, NAA delivers the acetate moiety to synthesize acetyl-CoA, which is further used for fatty acid generation (PMID: 24155240). NAT8L modulation may impinge on the metabolic reprogramming of cancer cells (PMID: 36580805). The calculated MW of NAT8L is around 33 kDa, and the observed MW is around 45 kDa.