Home
Products
Primary Antibodies
NBCe2 Polyclonal antibody, PBS Only (26150-1-PBS)

Filter: AllIHCIF/ICC

IHC staining of human liver cancer using 26150-1-AP (same clone as 26150-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 26150-1-AP (NBCe2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26150-1-PBS in a different storage buffer formulation.
IHC staining of mouse kidney using 26150-1-AP (same clone as 26150-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 26150-1-AP (NBCe2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26150-1-PBS in a different storage buffer formulation.
IHC staining of mouse kidney using 26150-1-AP (same clone as 26150-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 26150-1-AP (NBCe2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26150-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 26150-1-AP (same clone as 26150-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 26150-1-AP (NBCe2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26150-1-PBS in a different storage buffer formulation.
IF Staining of HepG2 using 26150-1-AP (same clone as 26150-1-PBS)
Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using NBCe2 antibody (26150-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 26150-1-PBS in a different storage buffer formulation.

NBCe2 Polyclonal antibody, PBS Only

NBCe2 Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 26150-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

26150-1-PBS targets NBCe2 in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag23558 Product name: Recombinant human SLC4A5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 953-1019 aa of BC109221 Sequence: NILPEKEKKETDKKRKRKKGAHEDCDEEPQFPPPSVIKIPMESVQSDPQNGIHCIARKRSSSWSYSL Predict reactive species
Full Name	solute carrier family 4, sodium bicarbonate cotransporter, member 5
Observed Molecular Weight	108-127 kDa
GenBank Accession Number	BC109221
Gene Symbol	SLC4A5
Gene ID (NCBI)	57835
RRID	AB_2918099
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9BY07
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

NBCe2, also named as SLC4A5 and NBC4, belongs to the anion exchanger (TC 2.A.31) family. NBCe2 mediates electrogenic Na+:HCO3 − transport, and can operate in both a 1:2, and 1:3 manner, but the transport stoichiometry as well as directionality have not been defined for the renal NBCe2. The expression of NBCe2 has been reported in nearly all kidney nephron segments and CDs, indicating that some species-specificity might be present (PMID: 32547422). NBCe2 has 8 isoforms with the molecular mass of 108-127 kDa.