NCAM1/CD56 Recombinant monoclonal antibody

• 

  IHC staining of human tonsillitis using 82715-3-RR

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 82715-3-RR (NCAM1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 82715-3-RR

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 82715-3-RR (NCAM1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 82715-3-RR

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 82715-3-RR (NCAM1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 82715-3-RR

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 82715-3-RR (NCAM1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human tonsillitis using 82715-3-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human tonsillitis tissue using NCAM1/CD56 antibody (82715-3-RR, Clone: 5N5 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 82715-3-RR

  Biolayer interferometry (BLl) kinetic assays of 82715-3-RR against Human NCAM1/CD56 were performed. The affinity constant is 1.45 nM.

NCAM1/CD56 Uni-rAb^® Recombinant Antibody for IHC, IF-P, ELISA

Cat No. 82715-3-RR

Clone No.5N5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF-P, ELISA

Synonyms

CD56, NCAM1, 5N5, MSK39, N CAM 1

---

Tested Applications

• Positive IHC detected in: human tonsillitis tissue, human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human tonsillitis tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)-P: IF-P : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

82715-3-RR targets NCAM1/CD56 in IHC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5528

  Product name: Recombinant human NCAM1/CD56 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 30-352 aa of BC047244

  Sequence: EISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAENKAGEQDATIHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEE

• Full Name: neural cell adhesion molecule 1
• Calculated Molecular Weight: 95 kDa
• GenBank Accession Number: BC047244
• Gene Symbol: NCAM1
• Gene ID (NCBI): 4684
• ENSEMBL Gene ID: ENSG00000149294
• RRID: AB_3670537
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P13591
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Neural cell adhesion molecule 1 (NCAM1, also known as CD56) is a cell adhesion glycoprotein of the immunoglobulin (Ig) superfamily. It is a multifunction protein involved in synaptic plasticity, neurodevelopment, and neurogenesis. NCAM1 is expressed on human neurons, glial cells, skeletal muscle cells, NK cells and a subset of T cells, and the expression is observed in a wide variety of human tumors, including myeloma, myeloid leukemia, neuroendocrine tumors, Wilms' tumor, neuroblastoma, and NK/T cell lymphomas. Three major isoforms of NCAM1, with molecular masses of 120, 140, and 180 kDa, are generated by alternative splicing of mRNA (PMID: 9696812). The glycosylphosphatidylinositol (GPI)-anchored NCAM120 and the transmembrane NCAM140 and NCAM180 consist of five Ig-like domains and two fibronection-type III repeats (FNIII). All three forms can be posttranslationally modified by addition of polysialic acid (PSA) (PMID: 14976519). Several other isoforms have also been described (PMID: 1856291).