NCAM1/CD56 Recombinant monoclonal antibody

NCAM1/CD56 Uni-rAb® Recombinant Antibody for IHC, IF-P, ELISA

Cat No. 82715-3-RR
Clone No.5N5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF-P, ELISA

CD56, NCAM1, 5N5, MSK39, N CAM 1

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman tonsillitis tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)-PIF-P : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82715-3-RR targets NCAM1/CD56 in IHC, IF-P, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5528

Product name: Recombinant human NCAM1/CD56 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 30-352 aa of BC047244

Sequence: EISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAENKAGEQDATIHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEE

Predict reactive species
Full Name neural cell adhesion molecule 1
Calculated Molecular Weight 95 kDa
GenBank Accession NumberBC047244
Gene Symbol NCAM1
Gene ID (NCBI) 4684
ENSEMBL Gene IDENSG00000149294
RRIDAB_3670537
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP13591
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Neural cell adhesion molecule 1 (NCAM1, also known as CD56) is a cell adhesion glycoprotein of the immunoglobulin (Ig) superfamily. It is a multifunction protein involved in synaptic plasticity, neurodevelopment, and neurogenesis. NCAM1 is expressed on human neurons, glial cells, skeletal muscle cells, NK cells and a subset of T cells, and the expression is observed in a wide variety of human tumors, including myeloma, myeloid leukemia, neuroendocrine tumors, Wilms' tumor, neuroblastoma, and NK/T cell lymphomas. Three major isoforms of NCAM1, with molecular masses of 120, 140, and 180 kDa, are generated by alternative splicing of mRNA (PMID: 9696812). The glycosylphosphatidylinositol (GPI)-anchored NCAM120 and the transmembrane NCAM140 and NCAM180 consist of five Ig-like domains and two fibronection-type III repeats (FNIII). All three forms can be posttranslationally modified by addition of polysialic acid (PSA) (PMID: 14976519). Several other isoforms have also been described (PMID: 1856291).

Protocols

Product Specific Protocols
IHC protocol for NCAM1/CD56 antibody 82715-3-RRDownload protocol
IF protocol for NCAM1/CD56 antibody 82715-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...