NCF1/p47 phox Polyclonal antibody

• 

  WB analysis using 28187-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28187-1-AP (p47 phox antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse spleen using 28187-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 28187-1-AP (p47 phox antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 28187-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 28187-1-AP (p47 phox antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

NCF1/p47 phox Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28187-1-AP

Publications(8)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

NCF1, p47 phox, NCF 1, NCF 47K, NCF-1

---

Tested Applications

• Positive WB detected in: U-937 cells, Raji cells
• Positive IHC detected in: mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 6 publications below
• IF: See 1 publications below

Product Information

28187-1-AP targets NCF1/p47 phox in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28089

  Product name: Recombinant human NCF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 31-190 aa of BC002816

  Sequence: KWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENRIIPHLPAPKWFDGQRAAENRQGTLTEYCSTLMSLPTKISRCPHLLDFFKVRPDDLKLPTDNQTKKPETYLMPKDGKSTATDITGPIILQTYRAIANYEKTSGSEMALSTGDVVEVVEKSE

• Full Name: neutrophil cytosolic factor 1
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC002816
• Gene Symbol: p47phox/NCF1
• Gene ID (NCBI): 653361
• RRID: AB_2881084
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P14598
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Hazard Mater; Graphene oxide disrupted mitochondrial homeostasis through inducing intracellular redox deviation and autophagy-lysosomal network dysfunction in SH-SY5Y cells.; Authors - Feng Xiaoli
rat	WB	Oxid Med Cell Longev; Human Tissue Kallikrein 1 Is Downregulated in Elderly Human Prostates and Possesses Potential In Vitro Antioxidative and Antifibrotic Effects in Rodent Prostates.; Authors - Mengyang Zhang
		Clin Nutr; Chlorogenic acid protects against liver fibrosis in vivo and in vitro through inhibition of oxidative stress.; Authors - Haitao Shi
rat	WB	Drug Des Devel Ther; Artemisinin Improves Acetylcholine-Induced Vasodilatation in Rats with Primary Hypertension; Authors - Xuanxuan Liu
mouse	WB	Biochem Biophys Res Commun; Liraglutide modulates ALCAT1-Mediated cardiolipin remodeling to improve cardiac function in obese mice; Authors - Lulu Wang
	WB	J Healthc Eng; Effect and Mechanism of Lidocaine Pretreatment Combined with Dexmedetomidine on Oxidative Stress in Patients with Intracranial Aneurysm Clipping.; Authors - Junting Zhang