Nucleolin/C23 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Nucleolin/C23 Polyclonal antibody, PBS Only (10556-1-PBS)

• 

  WB analysis using 10556-1-AP (same clone as 10556-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10556-1-AP (Nucleolin/C23 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10556-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 10556-1-AP (same clone as 10556-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 10556-1-AP (Nucleolin/C23 Antibody) at dilution of 1:1000 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 10556-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 10556-1-AP (same clone as 10556-1-PBS)

  IP result of anti-Nucleolin/C23 (IP:10556-1-AP, 4ug; Detection:10556-1-AP 1:1000) with HeLa cells lysate 3200ug. This data was developed using the same antibody clone with 10556-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 10556-1-AP (same clone as 10556-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10556-1-AP (Nucleolin/C23 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10556-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 10556-1-PBS

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using NCL antibody (10556-1-AP) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

• 

  IF Staining of HEK-293 using 10556-1-PBS

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using NCL antibody (10556-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

• 

  IF Staining of HEK-293 using 10556-1-AP (same clone as 10556-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using NCL antibody (10556-1-AP) at dilution of 1:1500 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), Alpha Tubulin antibody (66031-1-Ig, Clone: 1E4C11, red). This data was developed using the same antibody clone with 10556-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Nucleolin/C23 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10556-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

C23, nucleolin, FLJ45706, NCL, Protein C23

---

Product Information

10556-1-PBS targets Nucleolin/C23 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0859

  Product name: Recombinant human NCL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-482 aa of BC006494

  Sequence: MVKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQKKGKKAAATSAKKVVVSPTKKVAVATPAKKAAVTPGKKAAATPAKKTVTPAKAVTTPGKKGATPGKALVATPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMKAAAAAPASEDEDDEDDEDDEDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNSTWSGESKTLVLSNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEALNSCNKREIEGRAIRLELQGPRGSPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGFGGRGGGRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDHKPQGKKTKFE

• Full Name: nucleolin
• Calculated Molecular Weight: 76 kDa
• Observed Molecular Weight: 100-110 kDa
• GenBank Accession Number: BC006494
• Gene Symbol: NCL
• Gene ID (NCBI): 4691
• RRID: AB_2082423
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P19338
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Nucleolin, also known as C23, involved in the control of transcription of ribosomal RNA (rRNA) genes by RNA polymerase I, in nucleocytoplasmic transportation of ribosomal components, and in ribosome maturation and assembly. It associated with intranucleolar chromatin and pre-ribosomal particles, and induced chromatin decondensation by binding to histione H1. Also it has a role in the process of transcriptional elongation. Whilst mammalian nucleolin has a predicted molecular mass of approximately 77 kDa, the apparent molecular mass is between 100 and 110 kDa, and has been attributed to the amino acid composition of the N-terminal domain, which is highly phosphorylated. (PMID: 15925566)