NCOA5 Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of A431 using 85004-1-RR (same clone as 85004-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using NCOA5 antibody (85004-1-RR, Clone: 241969G3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 85004-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 85004-1-RR (same clone as 85004-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using NCOA5 antibody (85004-1-RR, Clone: 241969G3 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 85004-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HEK-293 using 85004-1-RR (same clone as 85004-1-PBS)

  1x10^6 HEK-293 cells were intracellularly stained with 0.25 ug NCOA5 Recombinant antibody (85004-1-RR, Clone:241969G3) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 85004-1-PBS in a different storage buffer formulation.

NCOA5 Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra), Indirect ELISA

Cat No. 85004-1-PBS

Clone No.241969G3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), Indirect ELISA

Synonyms

241969G3, CIA, Coactivator independent of AF-2, KIAA1637, NCoA-5

---

Product Information

85004-1-PBS targets NCOA5 in IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag14418

  Product name: Recombinant human NCOA5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 112-384 aa of BC056872

  Sequence: DMRDSRDPMYRREGSYDRYLRMDDYCRRKDDSYFDRYRDSFDGRGPPGPESQSRAKERLKREERRREELYRQYFEEIQRRFDAERPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNECREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLADNRYLTAEETDKIINYLRERKERLMRSSTDSLPG

• Full Name: nuclear receptor coactivator 5
• Calculated Molecular Weight: 579 aa, 66 kDa
• GenBank Accession Number: BC056872
• Gene Symbol: NCOA5
• Gene ID (NCBI): 57727
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9HCD5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Nuclear receptor coactivator 5 (NCOA5), also known as a coactivator independent of AF-2 (CIA), possesses both repressor and activator functions (PMID: 11113208). It can interact with Estrogen Receptor (ER) alpha and ER beta in a ligand-dependent manner. NCOA5 has been shown to regulate the ER alpha-mediated transcription and the c-Myc gene expression (PMID: 11113208; 15073177). Recently identified as a conserved component of pluripotent stem cells, mammalian NCOA5 may contribute to maintaining the pluripotent stem cell population (PMID: 24268775).