CoraLite® Plus 488-conjugated NCOA5 Recombinant monoclonal antibody

• 

  IF Staining of A431 using CL488-85004

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using CoraLite® Plus 488 NCOA5 antibody (CL488-85004, Clone: 241969G3 ) at dilution of 1:200, CL594-Phalloidin (red).

NCOA5 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-85004

Clone No.241969G3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

241969G3, CIA, Coactivator independent of AF-2, KIAA1637, NCoA-5

---

Tested Applications

• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85004 targets NCOA5 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag14418

  Product name: Recombinant human NCOA5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 112-384 aa of BC056872

  Sequence: DMRDSRDPMYRREGSYDRYLRMDDYCRRKDDSYFDRYRDSFDGRGPPGPESQSRAKERLKREERRREELYRQYFEEIQRRFDAERPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNECREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLADNRYLTAEETDKIINYLRERKERLMRSSTDSLPG

• Full Name: nuclear receptor coactivator 5
• Calculated Molecular Weight: 579 aa, 66 kDa
• GenBank Accession Number: BC056872
• Gene Symbol: NCOA5
• Gene ID (NCBI): 57727
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9HCD5
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Nuclear receptor coactivator 5 (NCOA5), also known as a coactivator independent of AF-2 (CIA), possesses both repressor and activator functions (PMID: 11113208). It can interact with Estrogen Receptor (ER) alpha and ER beta in a ligand-dependent manner. NCOA5 has been shown to regulate the ER alpha-mediated transcription and the c-Myc gene expression (PMID: 11113208; 15073177). Recently identified as a conserved component of pluripotent stem cells, mammalian NCOA5 may contribute to maintaining the pluripotent stem cell population (PMID: 24268775).